ELF>l@@8@@@@ OO   HxxxPPP ppp$$ StdPPP Ptd H H HQtdRtd   P6P6GNUGNUC^.O>2-sk/lib64/ld-linux-x86-64.so.2L!X%b:0b`XBDA)P"` b殈7g4?@q &Cl %'bh %,l}'#W qD(YGZH@ _/|Vb@ IZAemfUaa9i*dW#ț($.SK!TY; FUH&iC57UItkA/oK|=U$D;c<FD )o}sS'u#a4Gac}35{Gq(H]"uep,/1w<.PGAw7O3"N|/6ɅJ _D< \wh0pxJe):+3#>:|4o])qz:|w:wTtXlBtXc,Vi;tMx[KaMg/5*WyidIRR~bW ymW![JhVl#}pJgvU`m_t& % 4H%jKm8ACH3c;%77WTa nlNYJ)`hZ~5Ph.\wzwS?q L.'#~( { W{75@'NDG3gO(Dnw}2z'-oI>'ng2] \]ĹY4cpO q2K"cNvN|_*~Qzk)1Luk(ZT|s&<R3Uzh]L@+pF'kj_5}]C`Ovf=F2RMf H&Jq6lF~P70t8u_2I>I3If7%g^ERq[cO|e*^nN. P`atr)V.Y2"M?yP$ׇ r:߇w"]QBUz@3g}b|Ag{pmFcpO+As@jl0>\Zcy!s4@ ~'S =u177aM()  9uZO6u,un[r!BaZ01k1}eq[FZ(iDxp9xa3oc8XH &lZ6=-+OmZ$s) U5&{@>C{ "">E0!pR^jłS ?k_YR|onS!xXNEdsIS`Vuw_(;_jkwPxj 5|1^,7#,Ql3  z'H+ Z[7kL+S!~ &ECWk!C=L4BY`61I9!7f$!iX d1kimHwhKDKFPl> jqK-(w[To-,7Qk dtge6^MGs8H9QnE#)'|:lKr r+̆]y2qz]\+Px!/%L [X9& o$TV<N#aSM+G1^6O  hOW*$2AxA @\$?YvS .VZn4KNC{ tC]J\. dkf2b)!y"z~ u5:n;_!~w0<M`9 hY}*;^hG$rxE$ GPpE93oiu<wG$~raViktNtIl`>pI}68) 6I~$,S5?N;4x=!gN:C`l8D0V҇s[G';g[th%IQ Jgw&abPpC{lL.ph);yHT#G[lTq /TJXq)=9Y?G_ ZAT[B:<G~@8}Y9hFEbJ7Vmp<-$YxSPn0gN$Y0Kq\I9eaux'~{L/V)1.A{*0x jHH1fqlvP>}/)/*^TWD^ASbALP5NR%DL" ;&<ih] Zv8>h*fҀcF |@5)R$߄owga5#d@2<dGv]<Uc%cnMb'Z4M0?Va5D2X( WeON[;, [s^CÄh_"yT~:v;6[%8z`'&ccg{ -3dgO#0uo_FuJ OO Oyf~naJWbp"c<;#Y&uB;mms{B U&m UB0tf+#F&D:y;Vކ vx"@/=̇{HvdOZ ʀZkcW \#[o;IL2:u< BS'o _IX+3| 9 a&ze0~.9I_$;i[zI}orO-h;1?T,]L%%>l }bU05NACPhXtCq}Lm.:F89Cemy7WOK/Hw~J.\Ns߀y>elEGFlx>p9Q  m6;iyr  ">?m&5 | [[j< D H?/eb (F*^|!Qt4R_o'S0~v7f>WQ_e|* xgDh=^B~yU*stч+x@ 4b3y# vn%zWES?J-4ezso,m^y'dA_9XR]^qb(@9[xqcG(D\$_ W? gzV;7`4AF5Crc%ByFnaCM 4?#yx-"go\a`}s r5zve")jjrMDu1+-@ۂOYi/-'8Bok%XV fSQU82 Lj2T,UN}NPU,+(4OL>p#IjE"{NufHz)yf:BBzrs_ 1Cnn_XR "`r/HI, 5c&i`dY% d? k-AYe6=('?h HbDT;>, )v:).k 2 ~q%Hb:!b)aheYfWCHCGOL[8+KW(28*7%(mZOG`RJM1LY3XQ %.m3& K@|GnVW+Oj]IeW:j=^>m0o%<$E?}6F<"Pw#([ @.M8j?Z_ITM_deregisterTMCloneTable__gmon_start___ITM_registerTMCloneTableSSL_CTX_get0_certificateSSL_set_sessionSSL_is_serverSSL_SESSION_get_idSSL_get_errorSSL_CONF_cmdSSL_CTX_freeSSL_CTX_use_serverinfo_fileSSL_set_accept_stateSSL_alert_desc_string_longSSL_set_srp_server_paramSSL_get0_dane_tlsaSSL_CTX_set_srp_verify_param_callbackDTLS_server_methodSSL_get0_peer_CA_listSSL_set_post_handshake_authSSL_get_negotiated_client_cert_typeSSL_CTX_load_verify_fileSSL_SESSION_freeSSL_certs_clearSSL_get_ciphersSSL_SESSION_set_cipherSSL_readSSL_state_string_longSSL_CTX_set_max_early_dataSSL_set_blocking_modeSSL_SESSION_print_keylogSSL_CTX_set_default_verify_fileSSL_CTX_set_client_CA_listSSL_get_srp_NOSSL_QUIC_client_methodSSL_get_shared_sigalgsSSL_CTX_get0_ctlog_storeSSL_CTX_set1_server_cert_typeSSL_get_selected_srtp_profileSSL_CTX_ctrlSSL_CTX_set_next_protos_advertised_cbSSL_callback_ctrlSSL_CTX_set_stateless_cookie_verify_cbSSL_get_SSL_CTXSSL_CTX_sess_set_remove_cbSSL_get_srp_gSSL_CTX_set_ctlog_list_fileSSL_set_optionsSSL_verify_client_post_handshakeSSL_set_msg_callbackSSL_get_verify_resultSSL_CTX_get_cert_storeSSL_get_servernameSSL_CTX_set0_security_ex_dataSSL_use_certificateSSL_SESSION_set_protocol_versionSSL_SESSION_get0_cipherSSL_CTX_set_cookie_verify_cbSSL_CTX_set_srp_strengthSSL_CIPHER_findSSL_CIPHER_get_handshake_digestSSL_CTX_load_verify_dirSSL_CTX_configSSL_CONF_CTX_freeSSL_CTX_sess_set_get_cbSSL_CONF_CTX_finishSSL_CIPHER_descriptionSSL_has_pendingSSL_CTX_use_PrivateKey_fileSSL_CTX_set_psk_use_session_callbackSSL_statelessSSL_write_early_dataSSL_CTX_set_ciphersuitesSSL_clearSSL_connectSSL_is_quicSSL_set_bioSSL_SESSION_printSSL_CTX_set1_client_cert_typeSSL_CTX_set_psk_server_callbackSSL_sendfileSSL_get_sigalgsSSL_dane_tlsa_addSSL_use_PrivateKeySSL_session_reusedSSL_CTX_set_srp_cb_argSSL_CTX_set0_tmp_dh_pkeySSL_get_sessionSSL_get0_next_proto_negotiatedSSL_CTX_set_quiet_shutdownSSL_CTX_set_default_ctlog_list_fileSSL_get0_peer_certificateSSL_CTX_use_psk_identity_hintSSL_renegotiateSSL_get_event_timeoutSSL_CONF_CTX_set_ssl_ctxSSL_get0_dane_authoritySSL_SESSION_set1_master_keySSL_set_connect_stateSSL_SESSION_up_refSSL_CTX_set_keylog_callbackSSL_dane_set_flagsSSL_ct_is_enabledSSL_is_init_finishedSSL_CTX_compress_certsSSL_CTX_use_PrivateKeySSL_COMP_get_nameSSL_acceptSSL_CTX_get_security_callbackd2i_SSL_SESSION_exSSL_shutdownSSL_get_current_cipherSSL_writeDTLS_client_methodSSL_CIPHER_get_idSSL_net_read_desiredSSL_CTX_set1_paramSSL_get_optionsSSL_get_peer_signature_type_nidSSL_CTX_callback_ctrld2i_SSL_SESSIONSSL_SESSION_get_max_early_dataPEM_read_bio_SSL_SESSIONSSL_get1_builtin_sigalgsSSL_set_session_id_contextSSL_CTX_set_session_id_contextSSL_CTX_set_stateless_cookie_generate_cbSSL_get0_peer_sctsSSL_CTX_set_not_resumable_session_callbackSSL_CONF_CTX_newSSL_CTX_check_private_keySSL_check_chainSSL_CIPHER_get_versionSSL_dane_enableSSL_CTX_set_optionsSSL_CTX_set_next_proto_select_cbSSL_get_key_update_typeSSL_set_SSL_CTXSSL_CTX_set0_CA_listDTLSv1_listenSSL_CTX_set_psk_client_callbackSSL_get_srp_usernameSSL_CTX_sess_set_new_cbSSL_CIPHER_get_nameSSL_set_shutdownSSL_get_early_data_statusSSL_CTX_add_client_custom_extSSL_stream_concludeSSL_SESSION_newSSL_CTX_use_certificate_fileSSL_CTX_set_default_read_buffer_lenSSL_CTX_set_default_verify_dirSSL_get0_peernameSSL_CTX_set_alpn_protosSSL_waiting_for_asyncTLS_methodSSL_get_shared_ciphersSSL_CTX_set_psk_find_session_callbackSSL_handle_eventsSSL_load_client_CA_fileSSL_get_all_async_fdsSSL_CTX_set_cookie_generate_cbSSL_CTX_set_verifySSL_key_updateOPENSSL_cipher_nameSSL_CTX_load_verify_storeSSL_get_wbioSSL_get_versionOPENSSL_init_sslSSL_get0_peer_rpkSSL_SESSION_get0_peerSSL_CTX_set_alpn_select_cbSSL_net_write_desiredSSL_SESSION_set1_id_contextSSL_is_dtlsSSL_get_current_expansionSSL_get0_alpn_selectedSSL_select_next_protoSSL_read_early_dataSSL_get_certificateSSL_CTX_set_srp_username_callbackSSL_CIPHER_standard_nameSSL_set1_server_cert_typeSSL_do_handshakeSSL_get_current_compressionSSL_freeSSL_CONF_CTX_set_flagsSSL_CTX_set_default_verify_storeSSL_get_rbioSSL_CTX_set_info_callbackSSL_CTX_set_cert_storeSSL_get1_supported_ciphersSSL_CTX_set_srp_client_pwd_callbackSSL_add_file_cert_subjects_to_stackPEM_write_bio_SSL_SESSIONSSL_get_fdSSL_CTX_new_exSSL_CTX_set_client_cert_engineSSL_get_negotiated_server_cert_typeSSL_ctrlSSL_CTX_set_tlsext_max_fragment_lengthSSL_CTX_set_tlsext_use_srtpSSL_CTX_set_srp_usernameBIO_f_sslSSL_CTX_set_recv_max_early_dataSSL_set_verifySSL_set1_initial_peer_addrSSL_alert_type_string_longSSL_get_servername_typeBIO_ssl_shutdownSSL_newSSL_CTX_set_cert_cbSSL_export_keying_materialSSL_get_peer_cert_chainSSL_CTX_newSSL_has_matching_session_idSSL_CTX_set_security_callbacki2d_SSL_SESSIONSSL_CTX_set_generate_session_idSSL_CTX_enable_ctSSL_set1_client_cert_typeSSL_CTX_set_cipher_listSSL_traceSSL_CTX_dane_enableSSL_CTX_use_certificateSSL_group_to_nameOSSL_ENCODER_do_all_providedX509_PURPOSE_get_countOSSL_ENCODER_CTX_get_num_encodersPKCS12_SAFEBAG_get0_attrOSSL_DECODER_do_all_providedPKCS8_pkey_get0_attrsEVP_SIGNATURE_names_do_allBIO_ADDRINFO_familyX509_get0_pubkey_bitstrENGINE_load_public_keyBN_num_bitsASN1_GENERALIZEDTIME_printX509_POLICY_NODE_printNCONF_freeOSSL_STORE_SEARCH_by_aliasX509_STORE_CTX_get0_policy_treeEVP_PKEY_newENGINE_ctrlEVP_CIPHER_CTX_set_flagsOSSL_STORE_unregister_loaderEVP_EncryptUpdateEVP_PKEY_verify_recover_initASN1_item_freeRAND_get0_primaryBIO_bindEVP_DigestInit_exX509_NAME_entry_countEVP_sm3PKCS7_sign_exd2i_OCSP_RESPONSEPKCS12_SAFEBAG_get0_attrsSRP_create_verifierEVP_CIPHER_names_do_allASN1_UNIVERSALSTRING_to_stringOPENSSL_DIR_readASN1_TYPE_freeEVP_ASYM_CIPHER_is_aOPENSSL_buf2hexstrASN1_UTF8STRING_newNETSCAPE_SPKI_b64_encodeOPENSSL_sk_deleted2i_X509_REQ_bioUI_destroy_methodOSSL_CMP_ITAV_new0_certReqTemplateASN1_ITEM_lookupBIO_lookup_exPKCS12_init_exX509_STORE_set_default_paths_exX509_ocspid_printX509_REQ_set_pubkeyEVP_PKEY_decapsulateCMS_ContentInfo_print_ctxOSSL_CMP_ITAV_freeRAND_statusOCSP_onereq_get0_idEVP_MAC_fetchCMS_add1_signeri2d_OSSL_CRMF_CERTTEMPLATEOBJ_obj2nidOSSL_PARAM_get_int64OSSL_HTTP_proxy_connectNCONF_new_exGENERAL_NAME_freeERR_peek_last_errori2d_RSAPublicKey_bioX509_ATTRIBUTE_freeBN_is_zeroEVP_DigestVerifyFinalX509_CRL_get0_lastUpdateEVP_SIGNATURE_up_refOSSL_PARAM_get_uint64PKCS12_unpack_authsafesEVP_DigestInitX509_verifyOSSL_ENCODER_to_bioPKCS7_new_exEVP_KEM_settable_ctx_paramsOSSL_PARAM_construct_uintX509_STORE_CTX_initBIO_f_zlibEVP_MD_up_refEVP_CIPHER_do_all_providedi2d_PUBKEY_bioEVP_KEYEXCH_freeOSSL_CMP_CTX_push0_genm_ITAVOSSL_CMP_CTX_reqExtensions_have_SANBN_is_oddOSSL_CMP_CTX_get1_newChainOSSL_CMP_ATAV_get_rsaKeyLenX509_REQ_set0_distinguishing_idOSSL_STORE_INFO_get_typeUI_processPKCS7_get0_signersOSSL_STORE_INFO_freeOSSL_PARAM_construct_endX509_LOOKUP_fileCMS_get1_ReceiptRequestOPENSSL_LH_errorPEM_write_bio_X509_AUXOCSP_resp_get0_signatureOSSL_CRMF_CERTID_get0_serialNumberd2i_PKCS12_bioASYNC_cleanup_threadOSSL_ENCODER_CTX_set_passphraseEVP_CIPHER_get0_nameOSSL_CMP_CTX_set1_expected_senderOSSL_CMP_SRV_CTX_set_grant_implicit_confirmCRYPTO_strdupPEM_write_bio_CMS_streamEVP_PKEY_CTX_freeX509_set_subject_namea2i_GENERAL_NAMEEVP_CIPHER_get_nidOSSL_STORE_do_all_loadersCONF_loadEVP_SIGNATURE_get0_descriptionX509_EXTENSION_get_dataERR_set_errorOSSL_CRMF_MSG_centralkeygen_requestedCMS_RecipientInfo_typePKCS5_pbe2_set_scryptBN_printX509_keyid_set1BN_GENCB_freePKCS12_SAFEBAG_get0_bag_typeEVP_PKEY_meth_get0_infoBN_add_wordEVP_SIGNATURE_do_all_providedEVP_MD_names_do_allCMS_decrypt_set1_keyX509_CRL_printPKCS12_SAFEBAG_get1_certOSSL_CMP_CTX_reinitX509_VERIFY_PARAM_set_timeX509_digestOSSL_CMP_SRV_CTX_initCMS_add0_recipient_keyOSSL_CMP_CTX_set1_oldCertUI_method_set_prompt_constructorERR_newOSSL_CMP_CTX_set1_referenceValueEVP_MD_is_as2i_ASN1_INTEGEREVP_PKEY_missing_parametersEVP_MAC_is_aX509_to_X509_REQASN1_OCTET_STRING_freeTXT_DB_get_by_indexOCSP_check_validityX509_add1_trust_objectCMS_compressEVP_KEYEXCH_names_do_allOPENSSL_sk_sortOSSL_CMP_CTX_set_log_cbEVP_MAC_updateX509_CRL_load_httpOpenSSL_versionOSSL_CMP_ITAV_get0_typeOSSL_CRMF_CERTTEMPLATE_newASN1_TYPE_newOSSL_DECODER_CTX_freeOSSL_CMP_CTX_set0_reqExtensionsOSSL_CMP_CTX_print_errorsEVP_SKEYMGMT_up_refTS_REQ_set_nonceX509V3_EXT_REQ_add_nconfEVP_MD_gettable_paramsUI_method_get_closerOBJ_nid2objEVP_PKEY_asn1_get0X509_VERIFY_PARAM_set_auth_levelOPENSSL_sk_numPKCS7_sign_add_signerEVP_CIPHER_is_aOPENSSL_LH_freeBIO_readEVP_SKEYMGMT_fetchPBEPARAM_itASN1_item_d2iOSSL_PARAM_construct_intOSSL_ENCODER_up_refi2d_PKCS7_bioPKCS12_get0_macERR_get_errorOSSL_PROVIDER_add_conf_parameterX509_STORE_CTX_get0_parent_ctxOSSL_STORE_LOADER_newX509_CRL_verifyENGINE_get_idX509_subject_name_hashEVP_SIGNATURE_fetchEVP_SIGNATURE_is_aOSSL_CMP_CTX_set1_srvCertX509_add1_reject_objectEVP_KEYEXCH_get0_nameOSSL_ENCODER_fetchASN1_STRING_freeOSSL_STORE_LOADER_get0_providerEVP_CIPHER_CTX_set_paddingX509_check_ip_ascEVP_SKEYMGMT_freeX509_get0_pubkeyRAND_write_filePEM_read_bio_X509_REQX509_ALGOR_freeBIO_connectCMS_EncryptedData_decryptUI_add_verify_stringX509v3_get_ext_by_OBJX509V3_set_nconfNETSCAPE_SPKI_freeEVP_PKEY_verify_initEVP_PKEY_CTX_set_paramsOCSP_cert_status_strX509_add_certsASN1_INTEGER_to_BNX509_STORE_load_fileOSSL_PARAM_construct_octet_stringEVP_RAND_freeX509V3_set_ctxX509_CRL_get_issuerEVP_KEM_is_aTS_MSG_IMPRINT_set_algoEVP_SKEYMGMT_get0_nameX509_LOOKUP_hash_dirCRYPTO_memdupEVP_PKEY_sign_initBIO_free_allEVP_MAC_do_all_providedX509_NAME_get_index_by_OBJX509_get_default_cert_dirBIO_printfCMS_RecipientInfo_kari_get0_ctxX509V3_set_issuer_pkeyX509V3_parse_listOSSL_HTTP_getEVP_PKEY_asn1_find_strX509_ALGOR_itEVP_MD_do_all_sortedTS_RESP_verify_tokend2i_TS_REQ_bioASN1_tag2strX509_STORE_set1_paramX509_get_ext_countEVP_MD_CTX_set_pkey_ctxPBEPARAM_freei2d_X509_bioBIO_number_readOSSL_STORE_SEARCH_by_nameX509_CRL_digestEVP_sha256EVP_ASYM_CIPHER_names_do_allEVP_PKEY_encapsulate_initTS_TST_INFO_freeOCSP_request_onereq_get0EVP_CIPHER_CTX_get0_cipherEVP_MAC_CTX_get_mac_sizeOCSP_REQUEST_newX509_getm_notBeforeOPENSSL_DIR_endOSSL_CMP_CTX_set_transfer_cbOSSL_trace_beginCONF_modules_unloadOCSP_response_get1_basici2d_PKCS7_bio_streamTS_VERIFY_CTX_add_flagsOSSL_CMP_CTX_get_statusCRYPTO_mallocEVP_MD_gettable_ctx_paramsOSSL_STORE_findEVP_KEYEXCH_get0_descriptionBN_bn2decPKCS7_SIGNED_newASN1_PCTX_freeX509_REQ_sign_ctxASN1_item_unpackBIO_sock_should_retryOSSL_CMP_CTX_push1_subjectAltNameX509_get_pubkeyX509_OBJECT_get0_X509EVP_MAC_get0_descriptionEVP_PKEY_CTX_new_idEVP_MD_CTX_get_pkey_ctxX509_PURPOSE_get0OSSL_CMP_ITAV_new0_certProfileX509_time_adj_exOPENSSL_sk_shiftEVP_CIPHER_CTX_ctrlX509_STORE_CTX_set0_crlsX509_add_extENGINE_get_digest_engineOSSL_CMP_HDR_get0_transactionIDEVP_PKEY_CTX_get0_pkeyOSSL_STORE_INFO_get0_NAMEOSSL_PROVIDER_gettable_paramsi2a_ASN1_OBJECTX509_EXTENSION_freeNCONF_get_stringASN1_ENUMERATED_freeEVP_SKEY_get0_provider_nameX509_CRL_set1_lastUpdateOSSL_CMP_CTX_get0_untrustedOSSL_STORE_INFO_get0_PARAMSOPENSSL_asc2uniOCSP_response_status_strEVP_KEYEXCH_gettable_ctx_paramsEVP_SKEY_freeX509_ATTRIBUTE_get0_objectASN1_INTEGER_freeOSSL_STORE_eofEVP_PKEY_CTX_get_keygen_infoX509_CRL_add1_ext_i2dEVP_SKEYMGMT_do_all_providedTXT_DB_create_indexOCSP_id_get0_infoOSSL_DECODER_is_aASN1_STRING_print_exOSSL_CMP_CRLSTATUS_get0BIO_dump_indentEVP_SKEY_importBIO_debug_callback_exX509V3_add_valueEVP_MAC_get0_providerEVP_RAND_gettable_ctx_paramsX509_EXTENSION_get_objectX509_CRL_get0_signatured2i_PKCS8_PRIV_KEY_INFO_bioOSSL_CMP_SRV_CTX_get0_cmp_ctxEVP_PKEY_print_paramsX509_REQ_add1_attr_by_txtEVP_PKEY_print_publicEVP_RAND_get0_providerX509_chain_up_refX509_get0_extensionsBIO_s_connectEVP_PKEY_new_raw_private_keyBIO_sock_infoX509_REQ_set_subject_nameCMS_add1_recipientOSSL_CMP_ITAV_new_rootCaKeyUpdateOSSL_CMP_MSG_readOCSP_request_add1_nonceX509_STORE_set_flagsX509_STORE_add_certBIO_writeASN1_ENUMERATED_setEVP_PKEY_get_bn_paramBN_set_wordEVP_KDF_up_refTS_RESP_CTX_add_failure_infoOSSL_CMP_CTX_set1_untrustedPKCS7_verifyGENERAL_NAME_get0_valueASN1_TYPE_getCMS_data_create_exBIO_listenOCSP_basic_sign_ctxX509_NAME_ENTRY_get_dataERR_print_errorsTS_RESP_verify_responseOSSL_CMP_CTX_server_performEVP_RAND_CTX_get_paramsOSSL_STORE_LOADER_get0_schemeCMS_get0_SignerInfosBN_bn2hexUI_method_set_readerX509_NAME_delete_entryBIO_sock_initCMS_RecipientInfo_get0_pkey_ctxASN1_TIME_set_stringEVP_KDF_CTX_newEVP_CIPHER_get_modeOCSP_BASICRESP_newTS_VERIFY_CTX_newEVP_CIPHER_do_all_sortedX509_STORE_newPEM_read_bio_X509_CRLPKCS12_decrypt_skeyOPENSSL_sk_deep_copyi2t_ASN1_OBJECTOCSP_basic_add1_statusOSSL_CMP_CTX_push0_policyPKCS5_pbe2_set_ivEVP_PKEY_is_aEVP_PKEY_get_idOCSP_REQUEST_add_extOSSL_CMP_CTX_snprint_PKIStatusEVP_DigestSignUpdateUI_construct_promptX509_CRL_get0_nextUpdateERR_peek_errorASN1_INTEGER_newOSSL_STORE_loadEVP_MAC_CTX_set_paramsASN1_TIME_compareX509_NAME_ENTRY_freed2i_PKCS8_bioX509_OBJECT_freeTS_CONF_set_tsa_nameBIO_set_tcp_ndelayBIO_popTS_REQ_set_policy_idX509_NAME_add_entryOPENSSL_uni2utf8ASN1_generate_nconfOSSL_STORE_expectOSSL_CMP_CTX_set1_serialNumberCRYPTO_zallocOSSL_PROVIDER_set_default_search_pathEVP_ASYM_CIPHER_up_refOSSL_STORE_LOADER_up_refEVP_MD_CTX_get1_mdOBJ_txt2nidOSSL_DECODER_get0_descriptionOSSL_CMP_CTX_get_certConf_cb_argEVP_KDF_is_aEVP_PKEY_paramgenX509_alias_get0OSSL_CMP_MSG_itEVP_PKEY_CTX_set1_idX509_verify_cert_error_stringX509_VERIFY_PARAM_set_hostflagsCMS_sign_receiptBIO_new_fileBIO_ADDRINFO_protocolOSSL_PROVIDER_get_paramsX509_REVOKED_add1_ext_i2dCMS_uncompressOBJ_sn2nidEVP_KEYMGMT_get0_providerOPENSSL_hexstr2bufOCSP_SINGLERESP_add1_ext_i2dOSSL_ENCODER_is_aBN_rshift1PEM_read_bio_NETSCAPE_CERT_SEQUENCEX509_STORE_set_lookup_crlsPKCS12_SAFEBAG_get0_bag_objOSSL_PARAM_BLD_push_BNOSSL_CMP_get1_crlUpdateOBJ_new_nidBN_bin2bnEVP_MD_CTX_newTS_RESP_set_tst_infoASN1_i2d_bioX509_NAME_print_ex_fpOSSL_CMP_CTX_get_optionBIO_s_memEVP_MD_settable_ctx_paramsENGINE_get_cipher_engineX509_VERIFY_PARAM_get0i2b_PublicKey_bioOSSL_CMP_CTX_set1_pkeyASYNC_WAIT_CTX_freeOSSL_STORE_INFO_get0_CRLBN_optionsEVP_KDF_get0_providerX509_STORE_add_crlX509_CRL_set_issuer_nameOSSL_STORE_INFO_get0_PKEYBIO_ADDR_service_stringX509_STORE_freeTS_STATUS_INFO_newX509_policy_tree_get0_user_policiesOSSL_ENCODER_settable_ctx_paramsEVP_PKEY_paramgen_initBIO_socket_nbioERR_print_errors_fpSRP_VBASE_get1_by_userX509_NAME_freeTXT_DB_readOSSL_LIB_CTX_load_configEVP_PKEY_CTX_set_kem_opEVP_PKEY_up_refNCONF_get_sectionEC_get_builtin_curvesOCSP_CERTID_freeOSSL_CMP_PKISI_freeX509_REVOKED_set_revocationDateOSSL_STORE_LOADER_set_openCRYPTO_strndupEVP_PKEY_decapsulate_initTS_RESP_get_tst_infoEVP_md5UI_method_get_readerBIO_ADDRINFO_addressEVP_KEYEXCH_settable_ctx_paramsOSSL_STORE_open_exX509_NAME_add_entry_by_txtOSSL_DECODER_settable_ctx_paramsASN1_GENERALIZEDTIME_newBN_mod_expEVP_SKEY_get0_key_idOCSP_copy_nonceEVP_DecryptFinal_exPKCS7_newEVP_PKEY_signi2d_X509_CRL_bioX509_REQ_print_exX509_set_serialNumberX509_sign_ctxOSSL_PARAM_BLD_freed2i_OCSP_REQUESTBIO_f_cipherOSSL_STORE_supports_searchEVP_MD_do_all_providedOSSL_PARAM_BLD_to_paramASN1_GENERALIZEDTIME_freeOSSL_CMP_ATAV_push1OCSP_response_createEVP_MAC_get0_nameOSSL_CRMF_ATTRIBUTETYPEANDVALUE_freeBIO_set_callback_exPKCS12_SAFEBAG_get0_safesEVP_KEYMGMT_get0_nameEVP_DigestSignX509_getm_notAfterBIO_f_base64X509_set_versionEVP_RAND_up_refPKCS12_unpack_p7encdataOSSL_CMP_SRV_CTX_newX509_get_subject_nameERR_error_string_nEVP_KDF_get0_nameENGINE_get_RANDSRP_VBASE_initX509_policy_tree_get0_policiesEVP_MD_get_typeOSSL_STORE_LOADER_set_closeSCT_validation_status_stringCRYPTO_clear_freePKCS12_SAFEBAG_get0_pkcs8X509_REQ_get0_pubkeyEVP_des_ede3_cbcOPENSSL_sk_new_nullEVP_PKEY_copy_parametersPEM_read_bio_Parameters_exPEM_read_bio_ParametersOSSL_STORE_LOADER_set_errorPKCS7_to_TS_TST_INFOEVP_PKEY_keygenDIST_POINT_freeOSSL_CMP_snprint_PKIStatusInfoENGINE_ctrl_cmd_stringOSSL_CMP_ATAV_get0_typeX509_email_freeEVP_SIGNATURE_gettable_ctx_paramsEVP_DigestSignFinalOPENSSL_strlcatENGINE_get_pkey_methsOSSL_CMP_CTX_set1_senderNoncePEM_write_bio_X509OPENSSL_sk_pushBIO_freeEVP_PKEY_CTX_ctrlEVP_KEYEXCH_do_all_providedX509_NAME_hash_oldX509_REVOKED_set_serialNumberEVP_CIPHER_get_flagsBIO_f_prefixEVP_PKEY_get_group_nameEVP_MD_fetchOSSL_STORE_INFO_get1_PUBKEYOCSP_request_add0_idENGINE_load_private_keyOSSL_CMP_HDR_get0_geninfo_ITAVsBIO_get_callback_argOSSL_PARAM_modifiedEVP_ASYM_CIPHER_settable_ctx_paramsEVP_PKEY_fromdataEVP_DigestVerifyInit_exPEM_write_bio_PUBKEYSMIME_read_PKCS7_exOSSL_CMP_STATUSINFO_newEVP_Q_macOSSL_ENCODER_get0_propertiesEVP_DigestFinalXOFCMS_decrypt_set1_pkey_and_peerPKCS8_set0_pbeENGINE_get_RSAOSSL_CMP_CTX_get_http_cb_argX509_NAME_ENTRY_get_objectEVP_PKEY_get_default_digest_nameOSSL_CMP_CTX_get0_validatedSrvCertOSSL_STORE_register_loaderOSSL_DECODER_get0_propertiesOSSL_STORE_INFO_get1_CERTBIO_new_socketX509_reject_clearASN1_INTEGER_getOPENSSL_uni2ascOSSL_CMP_ITAV_get0_certProfilePEM_read_bio_PKCS7BIO_f_mdPBMAC1_get1_pbkdf2_paramASN1_INTEGER_cmpPEM_read_bio_PKCS8BIO_test_flagsPEM_write_bio_PrivateKey_traditionalENGINE_set_defaultBIO_ADDR_dupPKCS12_SAFEBAG_get_bag_nidOSSL_STORE_LOADER_get0_engineOSSL_DECODER_get0_nameOSSL_HTTP_transferX509_NAME_newX509_CRL_freeASN1_TIME_set_string_X509OBJ_nid2lnOSSL_PARAM_freeEVP_PKEY_CTX_set_dsa_paramgen_q_bitsOSSL_SELF_TEST_set_callbackASN1_TYPE_setEVP_KEYMGMT_freeOSSL_CMP_CTX_set_certConf_cb_argOSSL_CMP_CTX_set_transfer_cb_argOSSL_CMP_PKISI_newENGINE_register_all_completeEVP_MD_get_sizeEVP_SKEY_get0_skeymgmt_nameEVP_MAC_CTX_newEVP_sha1X509_get_ext_by_OBJEVP_MD_xofi2d_PKCS8_bioX509_CRL_set1_nextUpdatePEM_write_bio_X509_REQBIO_f_bufferEVP_RAND_do_all_providedASN1_item_i2dX509_INFO_freeCMS_ReceiptRequest_get0_valuesX509_LOOKUP_storeEVP_DigestVerifyUpdateTS_RESP_CTX_freeOPENSSL_strncasecmpOSSL_ENCODER_names_do_allEVP_CIPHER_CTX_get_block_sizeASN1_UTCTIME_freeUI_create_methodX509_CRL_get_ext_d2iOSSL_CMP_MSG_writeOSSL_ENCODER_CTX_set_cipherTS_CONF_set_certsEVP_DigestFinal_exUI_add_input_stringTS_CONF_set_ess_cert_id_chainOSSL_CMP_MSG_get0_certreq_publickeyEVP_ASYM_CIPHER_fetchX509_STORE_CTX_get1_chainCMS_finald2i_TS_RESP_bioBIO_s_fileNETSCAPE_SPKI_get_pubkeySMIME_write_CMSASN1_OCTET_STRING_newEVP_DigestEVP_SIGNATURE_get0_providerOSSL_CMP_CTX_set1_serverEVP_PKEY_dupUI_nullPBE2PARAM_freeOSSL_CMP_SRV_CTX_set_accept_raverifiedOSSL_CRMF_CERTID_get0_issuerPBKDF2PARAM_itX509_SIG_freeEVP_PKEY_checkPKCS12_SAFEBAG_set0_attrsOSSL_STORE_SEARCH_by_key_fingerprintOBJ_ln2nidEVP_KDF_CTX_set_paramsENGINE_get_digestsOSSL_CMP_CTX_set0_trustedStoreOBJ_nid2snEVP_KEM_fetchUI_freeTS_REQ_set_versionOSSL_CMP_CTX_set_http_cb_argOSSL_CMP_SRV_CTX_init_transSMIME_write_PKCS7BIO_ADDRINFO_socktypePEM_write_bio_RSA_PUBKEYOSSL_STORE_LOADER_is_aBIO_ADDR_freeEVP_MAC_finalNCONF_newOSSL_CMP_CTX_get0_newPkeyOSSL_CRMF_CERTTEMPLATE_fillEVP_KDF_settable_ctx_paramsOPENSSL_LH_newCMS_get0_signersOSSL_HTTP_adapt_proxyX509_REVOKED_newX509_check_hostPEM_read_bio_X509TS_CONF_set_signer_keyX509_get_default_cert_dir_envBIO_int_ctrlEVP_SKEYMGMT_get0_imp_settable_paramsEVP_ASYM_CIPHER_freeNCONF_load_bioX509_load_httpEVP_DecryptInit_exBIO_new_mem_bufOSSL_CMP_CTX_set1_proxyTS_CONF_set_clock_precision_digitsX509_alias_set1TS_STATUS_INFO_set_statusOBJ_txt2objEVP_PKEY_set_utf8_string_paramX509_CRL_diffTS_VERIFY_CTX_freeOSSL_CMP_CTX_set1_extraCertsOutPEM_write_bio_PKCS7PEM_write_bio_PKCS8OSSL_CMP_MSG_get_bodytypeASN1_TIME_freeOSSL_CMP_MSG_freeX509_VERIFY_PARAM_get0_namePEM_read_bio_PKCS8_PRIV_KEY_INFOSRP_user_pwd_freePKCS7_freeX509_add_certOCSP_resp_find_statusPBKDF2PARAM_freeASN1_TIME_printOPENSSL_strlcpyEVP_CipherTS_CONF_set_digestsASN1_parse_dumpOSSL_CMP_get1_certReqTemplateOSSL_DECODER_names_do_allOSSL_CMP_CTX_set_serverPortEVP_PKEY_get_base_idX509_print_exX509_VERIFY_PARAM_add0_policyASYNC_WAIT_CTX_get_all_fdsENGINE_by_idEVP_KEM_up_refUI_method_set_writerTS_VERIFY_CTX_set0_storeEVP_CIPHER_get0_providerOCSP_REQUEST_freeX509_VERIFY_PARAM_set1TS_REQ_newOSSL_STORE_LOADER_do_all_providedUI_get0_user_dataEVP_SIGNATURE_settable_ctx_paramsEVP_PKEY_CTX_set1_rsa_keygen_pubexpEVP_PKEY_CTX_set_dh_paramgen_prime_lenOSSL_CMP_SRV_CTX_set_accept_unprotectedX509_NAME_onelinei2d_TS_RESP_bioTS_CONF_set_signer_digestEVP_KEYMGMT_gen_settable_paramsX509_get0_notBeforei2d_X509_REQ_bioOSSL_ENCODER_get0_descriptionNCONF_get_number_eOSSL_CMP_ITAV_createENGINE_get_pkey_asn1_meth_strSCRYPT_PARAMS_freeUI_get_string_typeEVP_DigestVerifyEVP_SKEYMGMT_names_do_allPEM_write_bio_PKCS8_PRIV_KEY_INFOOSSL_CMP_SRV_CTX_get0_custom_ctxERR_set_markX509_STORE_CTX_new_exEVP_CIPHER_gettable_ctx_paramsOSSL_CMP_print_to_bioOPENSSL_sk_new_reserveOSSL_STORE_INFO_type_stringBIO_new_fdX509_STORE_load_storeOSSL_PARAM_locate_constX509V3_extensions_printBIO_new_fpX509_check_private_keyTS_CONF_set_orderingASYNC_init_threadX509_REQ_verify_exUI_set_resultEVP_PKEY_get_bitsOSSL_CMP_CTX_set_http_cbOSSL_STORE_LOADER_set_eofPEM_write_bio_X509_CRLASN1_UTCTIME_newX509_NAME_cmpEVP_KEYEXCH_is_aX509_ALGOR_get0TXT_DB_writeOSSL_ENCODER_CTX_set_passphrase_uiEVP_PKEY_get_utf8_string_paramX509_NAME_hash_exX509_get0_signatureX509_VERIFY_PARAM_get_countEVP_PKEY_meth_get_countPKCS12_SAFEBAG_freeEVP_PKEY_verifyEVP_PKEY_CTX_set_cbEVP_KEYMGMT_get0_descriptionOSSL_CMP_HDR_get0_recipNonceEVP_DigestFinalX509v3_get_extOSSL_CRMF_MSG_get0_regCtrl_oldCertIDERR_set_debugEVP_MD_freeOCSP_cert_id_newEVP_CIPHER_CTX_rand_keyEVP_CipherInit_exEVP_KDF_get0_descriptionTS_CONF_set_serialEVP_KDF_names_do_allCMS_SignerInfo_get0_pkey_ctxEVP_MAC_freeX509_STORE_CTX_get_explicit_policyBUF_reverseEVP_PKEY_set_paramsTS_CONF_set_def_policyPKCS7_encrypt_exOCSP_RESPONSE_itTXT_DB_insertOBJ_cmpi2d_OCSP_RESPONSETS_CONF_set_policiesX509_CRL_add0_revokedUI_method_set_closerd2i_PrivateKeyEVP_PKEY_CTX_is_aX509_time_adjOSSL_CMP_ATAVS_freeASN1_PCTX_set_str_flagsEVP_CIPHER_get_iv_lengthNETSCAPE_SPKI_verifyX509_get0_serialNumberEVP_PKEY_print_privateOSSL_PROVIDER_get0_nameBIO_f_nbio_testPOLICYINFO_freeOBJ_create_objectsASN1_TIME_diffOSSL_CMP_CTX_get1_caPubsTS_MSG_IMPRINT_newASN1_PCTX_newCMS_set1_eContentTypeX509_REQ_get_extensionsNETSCAPE_SPKI_b64_decodeEVP_KEYMGMT_gettable_paramsOBJ_NAME_do_all_sortedX509_ATTRIBUTE_createEVP_PKEY_encapsulatePKCS12_freeBIO_s_acceptOSSL_STORE_INFO_new_PUBKEYPKCS12_SAFEBAG_get_nidEVP_CIPHER_freei2d_TS_REQ_bioCMS_get1_certsTS_MSG_IMPRINT_set_msgASN1_INTEGER_setX509_subject_name_hash_oldEVP_PKEY_set_int_paramOSSL_STORE_SEARCH_by_issuer_serialX509_REQ_set_versionOBJ_createTS_REQ_print_bioEVP_SKEYMGMT_get0_descriptionPEM_write_bio_PKCS7_streamX509_get_issuer_nameOSSL_CMP_MSG_update_transactionIDASN1_OCTET_STRING_cmpASN1_get_objectBN_CTX_freeEVP_SIGNATURE_freeENGINE_get_nameEVP_CipherInit_SKEYOSSL_STORE_LOADER_names_do_allPEM_write_bio_ParametersX509_add1_ext_i2dTXT_DB_freeX509_STORE_CTX_newOCSP_crl_reason_strEVP_read_pw_stringASN1_GENERALIZEDTIME_set_stringUI_method_get_writerX509V3_EXT_CRL_add_nconfASN1_TIME_print_exBIO_set_flagsEVP_KDF_CTX_freeOSSL_PARAM_allocate_from_textOSSL_STORE_INFO_get0_NAME_descriptionX509_LOOKUP_ctrl_exEVP_DigestInit_ex2PKCS12_set_pbmac1_pbkdf2X509_STORE_CTX_get_num_untrustedPKCS7_add_certificateEVP_KEM_freeBIO_number_writtenX509_VERIFY_PARAM_set1_emailEVP_KEM_get0_descriptionASN1_UTF8STRING_freeX509_get0_notAfterX509_STORE_CTX_get_current_certEVP_PKEY_CTX_ctrl_strGENERAL_NAME_printOSSL_CMP_CTX_newEVP_MAC_gettable_ctx_paramsTS_RESP_CTX_newCMS_final_digestOSSL_STORE_INFO_get1_CRLTS_RESP_get_tokenEVP_KEYEXCH_up_refEVP_KEYEXCH_fetchEVP_PKEY_get_sizeCMS_add0_recipient_passwordEVP_PKEY_decrypt_initBN_newOSSL_CMP_CTX_set1_no_proxyERR_clear_last_markEVP_DecryptUpdateX509_set_pubkeyPKCS5_pbe_setOSSL_CMP_exec_GENM_sesEVP_PKEY_encryptEVP_KDF_gettable_paramsASN1_PCTX_set_flagsPKCS12_unpack_p7dataTS_RESP_newEVP_CIPHER_CTX_get_key_lengthBIO_ADDR_hostname_stringEVP_MAC_up_refEVP_SKEYMGMT_is_aOSSL_CMP_CTX_push0_geninfo_ITAVX509_get_serialNumberBIO_set_callback_argASN1_STRING_cmpBUF_MEM_growX509_printEVP_MD_get0_descriptionX509_STORE_get0_paramUI_OpenSSLX509_get1_ocspEVP_PKEY_CTX_set_dh_nidEVP_PKEY_set_octet_string_paramEVP_KEYMGMT_up_refTS_MSG_IMPRINT_freei2a_ASN1_INTEGERX509_get_extension_flagsEVP_CIPHER_get_key_lengthEVP_KEYMGMT_settable_paramsENGINE_freeX509_check_purposeBIO_newX509_VERIFY_PARAM_newOSSL_CMP_MSG_update_recipNonceOPENSSL_infoTS_TST_INFO_print_bioEVP_PKEY_CTX_set_dh_paramgen_generatorOCSP_request_signX509_VERIFY_PARAM_get0_hostEVP_PKEY_get0_type_nameOSSL_LIB_CTX_freeRAND_pollX509_PURPOSE_get0_snameEVP_CIPHER_fetchX509_set_issuer_nameOCSP_RESPONSE_printEVP_EncryptInit_exOPENSSL_LH_strhashEVP_KEM_names_do_allBN_bn2binENGINE_get_DSAX509_STORE_set_verify_cbOSSL_CMP_CTX_set1_secretValueEVP_CIPHER_settable_ctx_paramsBN_dec2bnPKCS7_print_ctxOPENSSL_sk_valueOSSL_STORE_INFO_get1_PARAMSEVP_PKEY_public_checkBIO_get_retry_reasonOCSP_REQUEST_printBIO_ADDRINFO_nextPEM_write_bioNETSCAPE_CERT_SEQUENCE_newEVP_RAND_get0_descriptionNETSCAPE_SPKI_newOSSL_ENCODER_get0_nameOSSL_DECODER_freeRAND_bytesEVP_PKEY_decryptEVP_get_digestbynameOSSL_CMP_get1_caCertsBN_generate_prime_exX509_issuer_name_hash_oldOSSL_PARAM_construct_size_tX509_CRL_sortOSSL_LIB_CTX_newOSSL_CMP_log_closeBN_randBUF_MEM_newPKCS7_finalTS_RESP_set_status_infoBN_GENCB_newOPENSSL_LH_insertEVP_RAND_get0_nameTS_CONF_set_crypto_deviceCMS_dataEVP_SKEYMGMT_get0_providerEVP_ASYM_CIPHER_get0_providerOSSL_DECODER_CTX_new_for_pkeyEVP_SKEYMGMT_get0_gen_settable_paramsRAND_load_fileASN1_item_i2d_mem_bioX509_ALGOR_newEVP_ASYM_CIPHER_get0_nameTS_VERIFY_CTX_set0_certsEVP_CIPHER_CTX_set_key_lengthEVP_MAC_names_do_allX509_LOOKUP_ctrlTS_RESP_freeEC_curve_nid2nistX509_REQ_newBIO_dumpENGINE_get_firstBIO_ADDR_rawportX509_cmp_timeOSSL_HTTP_parse_urlCONF_get1_default_config_fileX509_STORE_CTX_get_obj_by_subjectBIO_ctrlASN1_TIME_newOCSP_response_statusX509_CRL_sign_ctxOSSL_trace_endOSSL_CMP_ITAV_new_crlsX509_REQ_add1_attr_by_NIDX509_VERIFY_PARAM_set1_hostPEM_X509_INFO_read_bioX509_ATTRIBUTE_countEVP_get_cipherbynameOSSL_STORE_LOADER_set_loadEVP_PKEY_CTX_set_dsa_paramgen_bitsEVP_PKEY_derive_set_peerX509_REQ_check_private_keyOSSL_ENCODER_CTX_set_paramsEVP_PKEY_encrypt_initASYNC_is_capableUI_add_user_dataSCT_printOSSL_CMP_MSG_http_performNETSCAPE_SPKI_signASN1_OBJECT_freeEVP_SKEY_generateX509_gmtime_adjEVP_PKEY_verify_recoverOBJ_obj2txtEVP_KEM_do_all_providedOCSP_id_issuer_cmpX509V3_EXT_add_nconf_skEVP_PKEY_freeGENERAL_NAMES_freeOPENSSL_sk_pop_freeEVP_KDF_deriveEVP_PKEY_asn1_get_countEVP_DigestUpdatePKCS12_create_ex2PKCS8_PRIV_KEY_INFO_freeEVP_aes_256_cbcd2i_ASN1_TYPEBIO_socketX509V3_conf_freeOCSP_RESPONSE_freeCMS_decrypt_set1_passwordX509_STORE_load_pathEVP_RAND_gettable_paramsBIO_parse_hostservTS_STATUS_INFO_freeOPENSSL_cleanseEVP_PKEY_get0_asn1GENERAL_NAMES_newCMS_verify_receiptOSSL_PROVIDER_availableX509_STORE_CTX_freeENGINE_get_nexta2i_ASN1_INTEGERX509_VERIFY_PARAM_set1_ipX509_STORE_add_lookupX509_ALGOR_set0EVP_CIPHER_CTX_newEVP_CIPHER_up_refSRP_VBASE_newASYNC_start_jobEVP_KDF_freeCMS_ReceiptRequest_create0_exX509_STORE_CTX_set0_trusted_stackEVP_PKEY_meth_get0ERR_clear_errorCMS_digest_verifyOSSL_DECODER_fetchPKCS8_decryptOSSL_CMP_MSG_dupCRYPTO_reallocEVP_MAC_settable_ctx_paramsEVP_PKEY_CTX_set_ec_paramgen_curve_nidTS_CONF_set_ess_cert_id_digestEVP_KEYMGMT_fetchEVP_PKEY_add1_attr_by_NIDTS_REQ_freeOSSL_CMP_CTX_set_optionBN_cmpASN1_ITEM_getOSSL_DECODER_from_bioOSSL_CMP_ITAV_get0_crlStatusListOSSL_CMP_ATAV_new_algIdOSSL_ENCODER_freeOSSL_CMP_ATAV_get0_algIdSRP_check_known_gN_paramCMS_decryptTS_CONF_set_accuracyBIO_s_nullPKCS5_PBKDF2_HMACEVP_CIPHER_gettable_paramsEVP_ASYM_CIPHER_do_all_providedASN1_OCTET_STRING_setEVP_PKEY_CTX_new_from_nameNETSCAPE_CERT_SEQUENCE_freeEVP_RAND_settable_ctx_paramsOCSP_basic_verifyOSSL_STORE_LOADER_set_expectX509_PURPOSE_get_idTS_VERIFY_CTX_set0_imprintEVP_ASYM_CIPHER_get0_descriptionX509_VERIFY_PARAM_set_flagsCMS_digest_create_exX509_delete_extOSSL_PROVIDER_loadTS_RESP_create_responseOSSL_CMP_SRV_CTX_freeOSSL_CMP_MSG_get0_headerX509_up_refX509_VERIFY_PARAM_clear_flagsBUF_MEM_freeOSSL_CMP_CTX_freeEVP_SIGNATURE_get0_namePKCS12_SAFEBAG_get0_p8infOPENSSL_sk_freeOSSL_DECODER_get0_providerPEM_read_bioX509_STORE_CTX_get_errorX509_STORE_CTX_print_verify_cbUI_ctrlASN1_item_printEVP_PKEY_CTX_newASN1_item_d2i_bioPOLICYINFO_newPEM_write_bio_PrivateKeyENGINE_get_DHCRYPTO_memcmpOCSP_REQUEST_itOSSL_STORE_attachOSSL_CRMF_CERTTEMPLATE_freeEVP_ASYM_CIPHER_gettable_ctx_paramsEVP_PKEY_asn1_get0_infoOSSL_CMP_CTX_build_cert_chainOPENSSL_strcasecmpASN1_item_i2d_bioENGINE_get_ECOPENSSL_LH_retrieved2i_X509_CRL_bioOSSL_PARAM_construct_utf8_ptrOSSL_CMP_ITAV_get0_rootCaCertX509_check_emailOSSL_trace_enabledCMS_ContentInfo_freeBIO_getsOCSP_RESPONSE_newX509_new_exRAND_get0_publicOCSP_BASICRESP_freePKCS12_set_macX509_VERIFY_PARAM_set_purposeCMS_ReceiptRequest_freeX509_VERIFY_PARAM_lookupASN1_UTCTIME_set_stringPEM_write_bio_X509_REQ_NEWEVP_KEYMGMT_do_all_providedCMS_EncryptedData_encrypt_exBN_check_primeX509_CRL_set_versionX509_REQ_add_extensionsEVP_PKEY_CTX_set_rsa_keygen_primesEVP_PKEY_get0_RSAASN1_STRING_setEVP_MAC_initEVP_MD_CTX_freeUI_new_methodEVP_PKEY_param_checkX509_VERIFY_PARAM_get_flagsOSSL_CMP_CTX_set1_transactionIDEVP_PBE_findBIO_ADDRINFO_freeOSSL_PARAM_construct_utf8_stringUI_method_set_openerOSSL_CMP_CTX_get_transfer_cb_argEVP_PKEY_CTX_set_rsa_paddingPBE2PARAM_itEVP_PKEY_deriveTS_RESP_CTX_set_signer_digestEVP_CIPHER_CTX_freeX509V3_EXT_add_nconfOSSL_CMP_CTX_set1_certEVP_EncryptFinal_exX509_cmp_timeframeX509_NAME_add_entry_by_NIDEVP_KEYEXCH_get0_providerCONF_modules_loadX509_trust_clearOSSL_STORE_INFO_get0_CERTEVP_PKEY_CTX_set_rsa_keygen_bitsTS_RESP_CTX_set_status_infoBIO_snprintfPKCS12_SAFEBAG_get0_typeEVP_MD_get0_provideri2d_RSA_PUBKEY_bioASN1_d2i_bioPKCS12_verify_macOSSL_CMP_CTX_set1_p10CSRi2d_OSSL_CMP_ATAVSOSSL_STORE_INFO_get1_PKEYSMIME_read_CMS_exOCSP_check_nonceEVP_RAND_fetchSCRYPT_PARAMS_itEVP_KDF_fetchi2d_OCSP_REQUESTX509_VERIFY_PARAM_set_depthX509_REQ_freeEVP_CIPHER_get0_descriptionEVP_PKCS82PKEYEVP_DigestSignInitX509_VERIFY_PARAM_set1_ip_ascPEM_read_bio_CMSTS_REQ_set_msg_imprintOSSL_sleepOPENSSL_hexchar2intEVP_RAND_get_stateENGINE_get_ciphersCMS_sign_exBIO_closesocketASN1_STRING_lengthi2d_PKCS8_PRIV_KEY_INFO_bioOPENSSL_LH_doallX509_NAME_dupBN_CTX_newERR_pop_to_markTS_REQ_set_cert_reqX509_CRL_up_refCMS_add1_ReceiptRequestX509_SIG_get0EVP_KEM_gettable_ctx_paramsEVP_MAC_CTX_freeASN1_STRING_set_default_mask_ascNETSCAPE_SPKI_printX509_REQ_new_exX509_VERIFY_PARAM_freeX509_STORE_CTX_set_flagsEVP_KDF_do_all_providedX509_CRL_print_exOSSL_CMP_PKISI_dupPEM_write_bio_RSAPublicKeyOSSL_CMP_CTX_set0_newPkeyPKCS12_mac_presentOSSL_CMP_get1_rootCaKeyUpdateASN1_PRINTABLE_typeASN1_ENUMERATED_newOSSL_CMP_CTX_get1_extraCertsIni2d_PrivateKey_bioX509_NAME_print_exOSSL_CMP_ITAV_dupEVP_MAC_gettable_paramsTS_REQ_to_TS_VERIFY_CTXEVP_MAC_CTX_dupOSSL_STORE_INFO_get0_PUBKEYEVP_KDF_gettable_ctx_paramsOSSL_STACK_OF_X509_freeOCSP_cert_to_idX509_get1_emailPKCS7_decrypti2d_ASN1_TYPEUI_get_input_flagsSRP_get_default_gNEVP_DigestSignInit_exOCSP_request_onereq_countCMS_ContentInfo_new_exBIO_vprintfOSSL_STORE_SEARCH_freed2i_CMS_bioEVP_BytesToKeyEVP_RAND_CTX_get0_randOSSL_PROVIDER_get_capabilitiesPEM_write_bio_NETSCAPE_CERT_SEQUENCEX509_CRL_new_exRAND_get0_privateEVP_PKEY_fromdata_initEVP_PKEY_CTX_new_from_pkeyOSSL_CMP_CTX_set1_serverPathOSSL_PARAM_BLD_newTS_CONF_get_tsa_sectionOSSL_STORE_INFO_new_PKEYOSSL_CMP_CTX_set1_subjectNamei2d_KeyParams_bioOSSL_ENCODER_CTX_freei2d_PKCS12_bioX509_get_exti2d_CMS_bio_streamX509_get_signature_nidEVP_sha512NETSCAPE_SPKI_set_pubkeyEVP_PKEY_CTX_settable_paramsOSSL_DECODER_up_refX509_PUBKEY_get0EVP_PKEY_derive_initOSSL_CMP_exec_RR_sesCMS_encrypt_exX509_PURPOSE_get0_nameX509_NAME_get_index_by_NIDEVP_PKEY_keygen_initENGINE_initCRYPTO_freeBN_freeBIO_ADDR_newX509at_add1_attrEVP_PKEY_CTX_set_app_dataEVP_KEYMGMT_is_aOSSL_CMP_SRV_CTX_set_send_unprotected_errorsUI_method_get_openerOSSL_CMP_CTX_set1_recipientTS_RESP_print_bioTS_CONF_set_signer_certX509_digest_sigOSSL_CMP_ITAV_new_caCertsX509_set0_distinguishing_idEVP_PKEY2PKCS8EVP_KEYMGMT_names_do_allEVP_KEM_get0_providerBIO_ADDR_rawaddressEVP_KEM_get0_nameOSSL_PARAM_set_all_unmodifiedd2i_PKCS7_bioX509_dupX509_STORE_CTX_get_error_depthBIO_accept_exOPENSSL_LH_set_thunksOSSL_CMP_exec_certreqEVP_MD_get0_nameOSSL_PROVIDER_do_allX509_verify_certOSSL_ENCODER_CTX_new_for_pkeyBIO_read_exOSSL_STORE_LOADER_freeBN_to_ASN1_INTEGERX509_REQ_get_subject_nameEVP_PKEY_CTX_get_app_dataOSSL_STORE_closeASN1_STRING_get0_dataOPENSSL_dieX509_NAME_get_entryBIO_new_dgramX509_get_ext_d2iOSSL_PROVIDER_unloadBIO_pushASN1_PCTX_set_nm_flagsOSSL_STORE_errorCMS_verifyX509_issuer_name_hashOSSL_CMP_CTX_set1_issuerTS_VERIFY_CTX_set0_dataX509_PURPOSE_get_by_snameX509V3_EXT_nconfOSSL_CMP_ATAV_new_rsaKeyLenBN_hex2bnOPENSSL_sk_newEVP_DigestVerifyInitOSSL_ENCODER_get0_providerASYNC_WAIT_CTX_newBIO_putsBIO_f_zstdENGINE_ctrl_cmdENGINE_finishX509_ATTRIBUTE_get0_typefgetsstrcpylstatstdinsetsockoptperrorstrncpysysconfsymlink__ctype_toupper_loc__stack_chk_fail__printf_chksetbuf__fdelt_chktimesstrrchrputcharunlinkfflushstrtodstrtoumaxstrtokstrtolsetpgidforkstrlen__ctype_b_loc__memcpy_chkstrstrwait__strncpy_chkgetpidreadlinkstdoutisatty_exit__fprintf_chk__libc_start_mainstderrfdopen__memset_chkopenlog__cxa_finalizemlockstrchr__syslog_chkstrerrorkillgetenvfclosememsetfputcrenamewaitpidsignal__isoc99_sscanfaccessstrtoulmemcpyfilenofwriteselectstrcmpqsortstrtoimax__errno_locationpipefstatstrncmp__strncat_chkalarmlibssl.so.3libcrypto.so.3libc.so.6OPENSSL_3.4.0OPENSSL_3.2.0OPENSSL_3.0.0GLIBC_2.15GLIBC_2.4GLIBC_2.7GLIBC_2.33GLIBC_2.14GLIBC_2.34GLIBC_2.3GLIBC_2.2.5GLIBC_2.3.4OPENSSL_3.0.9OPENSSL_3.0.3OPENSSL_3.3.0OPENSSL_3.5.0                               @ /p -p& +p4 Bii Mii Wal wii ui ti )+p#+p  .p  0p Έ /p -p& +p4 m @m    ͺ     _  W  U (( P@0 <@8 @ H P X h` `h p ؿx п ȿ         (@  x t p h ` X P H $@ ( 0 8 @ H 8@P 4@X 0@` h p x             x p X P H @ 8 0 (  ( 0 8 H@@ @@H @P 0X (`  h p x      @  ؾ о Ⱦ        x p h ` X( P0 H8 @@ 8H 0P (X  ` h p x  @   @       ܽ ؽH- M Q [  ( @ P ` p        & + 0 6 @/@ P8@ `A@ pJ@ S@ ``@@f? @\@ Xf@ po@ x@ @ @ @ @ @ @ 0@ H@ `@ x@ @ @ @ @  A A -A 8=A P > h'> MA UA [A dA mA vA A A A 0A @A PA `A pA A A A A A A B B B ,B 9B 0DB @MB PWB `aB pkB uB B B B B B B B B B B 0B @B PB ` C pC %C 3C /@ 8@ A@ J@ S@ AC HC PC 0XC @`C PhC `pC I8 M8    i  i R8 yC v 0\8 @f P ` p     :  q C C C C 0 @q PS `C pu  x C C  C C X X 0X HX `X xж X X X X  Y ) Y 8"Y P7Y hKY YY `Y hY nY D * tY (}Y @Y XY pOY Y Y Y Y Y Y 8Y PY hY Y Y Z Z Z %Z 3Z (?Z @IZ XSZ  q] d =d  j j 6j Fj Uj dj qj ~j 0k @j Pj `j p j j j j j  k k (k 6k   Gk 0^k @sk P}k ` pk k k Lm E   * .  E L Z 0 u 8 K H  P ) ` 0u h a x g   j   `u  u E u ò !u !˲ !v (!ղ 8!ڲ @!EP! X!Eh! p!+Q !" !w !5 !N !0v !E! !E" " " (" 8" @"{& P" X" h"% p"K "> "Z " "X "@ ") "h "` " "h "؅ #o #u #ɷ (# 0# @#8 H# X#h `#y[ p# x#E# #Q # #iE #Ȇ #T # #' #л #E$ $ $ $ж 0$ 8$ H$H P$Ҹ `$ h$ x$ $< $ $# $. $^ $ $F $P $ $h $ % %f %؈ (%n 8%y @% P% X%Eh% p%f % % % %Q %8 % %p %g % %VT %ʼ &. & &ּ (&( 0& @&X H&߼ X&x `&Ep& x& & &DT & &z & & & &: & &B 'M 'M 'H 'V 0' 8'e H'؋ P'w `' h' x'h ' ' ' 'Ќ ' ' '8 ' 'E'˽ ' ( ( (P ((E8( @( P(x X( h( p( ( ( ( (E(?_ (* (P )E) )E() 0) @) H)EX) `) p)Ȏ x)` ) ) )ž ) ) )E) )l\ ) )5$ * *P$ *8 *o$ 0*X 8*$ H*x P* `* h*E x* * * *E* * *x * * * * * + +E +?_ (+LD 8+ `+ p+ x+Q + +T + +, +P +E+ + + + , ,E, , 0,8 8,! H, P,E`, h,) x,( ,2 ,p ,E, ,: , ,A ,@ ,L ,h ,Z - - I - (-E8-@ @-EP- X- h- p-d - -E-h -l - -q - - -H - - . . . (. 0.E@.X H. X. `. p. x. .( . .h .E. . . . . .E/X / / /E0/ 8/EH/ P/1V `/h h/Ex/ /R / / /@ /E/ /E/ / / /E0 0 0p (0 80 @0EP0 X06 h0P p0 0 0 0 0) 0@ 05 0 0E0 0 0 1E1C 1] (1@ 01\ @1 H1d X1 `1r p1( x1 1x 1E1 1E1 1 1` 1 1 1 2 2 2@ 2 02 82 H2 P2 `2 h2 x2h 2 2 2 2 2 2( 2E2` 2 2 2a 3 3VT 3 (3E83` @3EP3 X3 h3 p3g 3 3 3X 3h 3 3 3 3 38 3E3 4 4 4E(4 04. @4 H4, X4P `4Q p4 x44 4 4y[ 4 4E4h 4E4 4 4x 4 5 5 5 5 05 85EH5˽ P5 `5 h5 x5P 5E5> 5W 5 5` 5 5i 5@ 5q 5p 5} 6 6 6 (6E86H @6 P6p X6Eh6 p6o 6 6 6( 6 6p 6 6 6 6 6 60 7 7p 7 (7 07 @7 H7EX7 `7#' p78 x7 7p 7 7 7 7 7 7 79 7` 7A 8 8M 8 8Y 08 88g H8H P8p `8 h8y x8 8E8 8 8P 8 8 8 8 8 8 8 90 9 9x (9 89 @9 P9 X9 h9P p9 9 9 9 9m 9 9 9h 9 9 9) 9 :4 : :E (:P 0:E@: H:EX: `:U p:( x:h :` :z : :E: :' : : : : ; ; ; ; 0; 8; H; P;) `;9 h;P x;] ;q ;{ ; ; ; ; ; ;@ ; ; ; < < <h (<. 8< @<: P< X<F h< p<R <_ <| < < < < < < <H < < = =p = (= 0=6 @= H=D X= `=R p= x=` = =E= = = =E> >K > >) 0> 8>Q H> P>E`> h>@ x> >@ > >p > >@ >% >; >B >Z > >g ?( ?h ?h (?v 8? @? P? X? h? p? ?  ? ?P ? ? ? ? ? ? ? ? @E@ @Z (@ 0@+ @@ H@3 X@; `@m p@O x@v @d @t @| @ @H @ @ @ @ @EA A A A 0A 8A HAP PA `A hA xA A A AQ A Ay[ A  AEA A Ax A B B B (B 8B @BEPB˽ XB hB pB BP BEBP B B B7 B= BQ Bx B B C C CY (Ce 0C| @C HC XC `C pC xC C( CEC Cf C C C C) Cp CED D2 D D8 0DA 8DT HD@ PD\ `Dp hDc xD Dn D D~ D D D  D D` D D DEE E E (E 8E @E PE8 XE hE` pE E E E E E E2 E E! E0 EM E0 FW FX Fa (Fx 0FJ @F HFT XF `F^ pF xFEF F Fi F F F> FP F F F G G G G I 0G 8GEHG PGa `Gx hG xG G G G G GEG G' G G G G H H H (H 8H @H PH XH) hH9 pHP H] Hq H{ H H H H H H@ H H I I I (Ih 0I. @I HI: XI `IF pI xIR I_ I| I I I I I I IH I J J Jp J 0J 8J6 HJ PJD `J hJR xJ J` J JEJ J J J@ K KEK- KK 0K= 8KZ HK PKg `K hKQ xK KEK K) KX K+ Ku K` K K> KH KL L LQ Lh (L 8L @L PL XLEhL pL1V L L{ L L L La L L L L L' M8 M M? (M 0ME@M HMW XM0 `MM pMX xMa M MJ M MT M M^ M MEM M Nx N N N 0N 8N HN NEN N N NEN- NK N NZ N N O O) O (OE8O @O) PO XO+ hO pOEO O Ox O O O O O O PEP PE(P 0P @P HP XPQ `Py[ pP  xP^ P P P PEP P P0 P PX P) Q QQ Q Q 0Qj 8Q HQ| PQ `Q hQ[ xQ Q! Q QEQ Qp Q Q@ Qp Q Q Q RX Rh R (R 8R @R PR XR hR pR R R R RER˽ R R R RP RER S Sx S (S 0S @S HS XS `SEpS?_ xS SX SES  SES S T T T0 TH 0T@ 8Ty[ HT  PTE`T- hTK xT TZ TQ TET T) T T+ Tj T> Tp Ta U Uf U (Uo 8U @U; PU( XU hU pU{& U UEU˽ U U U UP UEU U Ux V V V (V 0V @V HVEXV?_ `V pV` VEV V V V V V V W W( W (W 0Wy[ @W  HWEXW- `WK pW xWZ WP W W W W WEW W) W W+ X Xa X X> 0X- 8XG HXC PX^ `X hXe xX XEX X Xx X X X X X X YE0Y  8YEHY PY `Y hYy[ xY  YEY- YK Y YZ Y YEY Y) Y Y+ Z Z> Z (Za 8Z @Z PZ XZ{& hZ pZ Z ZEZ˽ Z Z Z ZP ZEZ Z Zx [ [ [ ([ 0[ @[ H[EX[?_ `[ p[P x[ [ [E[ [ [ [y[ \ \E\- \K 0\ 8\Z H\ P\ `\ h\ x\ \ \ \ \ \ \ \ \ \E\ \) ] ]+ ] (]a 8] @]> P] X] h] p]^ ] ] ]0 ]e ] ]E] ] ]x ] ] ^ ^ ^ (^ `^Ep^ x^ ^ ^ ^h ^y[ ^ ^ ^ ^K ^ ^Z _ _) _ _+ 0_u 8_EH_ P_> `_ h_a x_ _ _ _E_3 _ _G _b _ _n _( _iE `` ` ` (`E8`˽ @` P` X` h`P p`E` ` `x ` ` ` ` ` ` aEa a (a 0a @a Ha Xa `aY pa xa[ a a5 a aW a ay[ a aEa- aK b b b b% 0b+ 8bEHb Pb) `b hb xbE b b b< b( b bW b[M b` bEb4 bi c c co (c 8c @c! Pc Xc hc pc c c c c9 c cf c c c! cEc db d8! dE(dp! 0d @d Hd Xd! `dEpd xdj d! d d" d dP" d d dEd˽ d e e eP eE0e 8e Hex Pe `e he xe e e eEe" eEe e f f f# f. 0fH# 8f2 Hf# PfE`f hf xf# f9 f# f8 f$ f7 f@$ f f`$ f< f$ fEg$ gE g?_ (gy[ 8g? `gEpg$ xgEg g g gEg?_ g[ gb hEh h (h 0h @h& Hh@ Xh& `h ph' xh h h h8' hb hh' hx h' h h( h i8( i ip( i 0i 8i Hi( Pi! `i( hi8 xiG ia ip i i i i) i i@) i ih) i j j j) (j. 8j@ @jU Pj) Xjk hj) pj j* j j@* j@ j j j j jh* j j k> kO kk (k{ 0k @k Hk Xk `k pk* xk k* kEk- kK k* kEk k) k* k lG= l l(+ lE0lP+ 8la Hl+ Pl `l+ hl xl+ lQ lG l{& lc lEl8, lEm m m (my[ 8m @mEPm Xm) hm`, pme m mEm˽ m m m mP mEm m mx n n n (n 0n @n Hn Xn, `n pn xn{& n nEn?_ n n, nEn n o oy[ o (op 8oz @o Po Xo ho. po{& o(. o oX. oQ o oEo o) o o o p+ p p (p 0p @p Hp> Xp' `p pp. xpEp p px p p p p p p pEq˽ q q q 0qP 8qEHq. qEq qEq q q qy[ q qEq- qo r/ r r 0 (r 8r 0 @rEPr Xr) hrX0 pre r r r r r r{& r r r0 r r, sEs˽ s (s 0s @sP HsEXs `s psx xs s s s s s sEs?_ s s tE0t 8t Ht PtE`t ht1 xt0 t; t0 tF t0 tQ t(1 tX tc t t t u u uyN (u 8u `uEpum xuEu u u u uP1 uLD u uh u u v vEv1 v 0v1 8vEHv Pv) `v hv xv1 vEv v vx v v v v v v vEw?_ w w @wEPw Xw hw pwEw wo wb w wu w w w w w w x x x (x4 0x @xH4 Hx Xxp4 `x) px4 xx: x4 xL x 5 x[ xP5 x3 xx5 xk xt x y y y y 0y5 8y Hy5 Py `y5 hy xy y y6 y/ y86 yE y[ yy y y y y z`6 z z6 (zo$ 8z6 @z$ Pz7 Xz hz pz z zQ z zWN zP7 z2 zx7 zEz z zx { { { ({ 0{ @{ `{Ep{ x{E{ { { { {7 {LD { {h { {E|P+ |E|- |K 0|7 8|EH| P|) `| h| x|1 |E| | |x | | | | | | |E}?_ } } @}EP} X} h} p}E}- }K } }E} } } }) } }E} ~ ~x ~ (~ 0~ @~ H~ X~ ~E~ ~ ~ ~ ~p: ~M ~0 ~W ~X ~a x J  (T 8 @^ P XEh p- :  : 7 ;  @; 8 x; N   ;  (; 0 @< H X@< ` ph< x   <  <  Ѐ< ؀  =  H=  x=  0= 8] H P8 `= h x> E= / N  H> ȁ#' ؁\  u  p>   (E8 @) P X h pL   >  >  Ȃ? Ђ 0? > P?   4 (> 0Z @c H Xx? ` p? x ?  @  P@  Ѓ ؃ x@ VT @ R @  0A 8 H@A P `hA h xA 1V   % E Ȅ' ؄       ( 8 @ P X) h9 pP ] q {    ȅ Ѕ @      (h 0. @ H: X `F p xR _ |     І ؆ H    p  0 86 H PD ` hR x `  E  x ȇ ؇     @EPB XEh p  E?_  B EC E   (E8- @K P2 X hC p_ K E {& e  ȉq Љ  E    (C 0; @C H XD `o p x HD E˽    ЊP ؊E  x    0 8 H PE`?_ h xpD E  ȋ ЋK  )    e ( 0 @xI H( XI `0 p7 xT Q a I ( J y[ Ќ ،E  x    0 8 H PE`˽ h x  P EHJ  xJ ȍ ؍k  J    J ( 8 @ PJ XEhK p!   @K ) pK  ȎK ЎCK K EK ] 8L M ( 0W @ Ha X `J p xT  ^  iE &  ЏhL ؏ @  L  L  0L 8 HM PS `HM h xM  M [ N i 0N Ȑ ؐ`N  N  z  N ( 8 @ P X hN E  ȑ Бy[  E- K  Z ( 0E@ H+ X `) p xa  > XO  O  ВO ؒ{& O E  x  0 8 H P ` E   y[  ȓ ؓ   1 (P E - (K 8 @Z P7 X h pQ XP E )  + ȔY Дt z e   P  ( 0 @ H XP `EpP xE      Е ؕ. 7 E˽    0P 8EH P `x h x     E   y[  (E8 @ Px X h p       ȗ ЗE- K  Z 8R  ( 0 @hR HEX `) pR x+ R  R e  S  ИHS ؘ^ S a S > S  0T 8 H0T P `hT E   y[  ș ؙJ E- K  E  () 8 @> Pf Xa hT pE  x    Ț К  E  ( 0y[ @ H^ X`Y `p pY x@ * @ Y @ Y A ЛZ ؛H N h n Q  E0- 8K H= P `HZ h x    pZ  Z Ȝ ؜Z \Y Z  [ Q 8[ (E8 @) P Xa hp[ p [    [ Eȝ(\ Н X\ h \  \  (] 0 @  H X$ `@ p`] xE˽    P EО ؞ x      0 `Ep] xE     * П ؟E  1 @ < M 0] 8EH P `x h x     E?_ Ƞ1 ؠ] Ep^ E( 0 @ Hy[ X `Ep x)      EС˽ ء   P E  0x 8 H P ` h x E?_ ^ - E_ E   ( 8 @) P_ X h_ p~ 0 E   Eȣ У x      ( 0E@?_ HM X` E   LD m Ȥy[ ؤ   m K n Z  (@ 88n @EP X h pQ $ T `n ж n  ȥ Х: A > ^  n s (n 0N @(o Hz X`o `Ep x o  I o   # Ц ئF   o    0 p 8 HPp Pd ` h xp  p E g q ȧQ ا Q  ]    Pq (e 8 @: Pq X h\ p X ߼ x   EȨ Ш)  +  o q  ( 0{& @ H X ` pJ xa * < q G C EЩ˽ ة   P E  0x 8 H P ` h x E  Ȫ Ъ    y[  E(- 0K @ HZ X ` p x    E ) Ы ث+ pr ^    e 0 8a H P> `- hG x.  0 EH   Ȭ ج(   E  x ( 8 @ P X h E  ȭ Эp  @ * @  @ ( 0y[ @ HEX- `K p x r Q 8[  r  Юr خ\Y Z   E ) 0 8 H P `s h x    @s   ȯEد˽    P E  ( 8x @ P X h p  Eh EȰ а  y[  ;  M (Ѕ 0 @ HX X8 `] pg xE}   #'  %c б` ر       0 8 H0 P; ` h x  `     Ȳ& ز 4  = K E b (VT 8X @. Px X. h pu  g  Q 8  ȳh г@    W  M ( 0a @ HJ X `T p x^       д ش    o 2  0? 8W H` PiE ` hExc !  u ~   ȵEص   {&   H ( 8 @ ! Pp X! h p!  %! ( ,! ` Eȶ;! жK!  ! U! b! f! }! ( 0! @! H X! `! p x! ( ! X ! x " з ط" " ," ȍ 7" ;" S" 0 8Q" H0 P^" `p hj" x z ؎ "  " H ȸ" ظ " " E 5$ " (P$ 8" @o$ P" X$ h" p" " # # -  # ȹ # й7# =# M# U# g#  Lm (t# 0# @h H# X `# pȐ x#  # @ # p # к غ# ؑ #  $ @ E0˽ 8 H P `P hEx$ $ $ 2$ :$ M$ W$ Ȼl$ ػv$ $ $ $ $ $ p ($ 8$ @$ P X% hȒ p%  % ( (% H =% ȼx мn R% %  m%  % ( 0% @P H% X `% p xK  % P %   н ؽ    LD P  0 8% H P% ` h% x  & 8  & x -&  Ⱦ4& ؾȗ E '    ( 8 @ P X h p  ) 9 P ] q ȿ{ п     @  ( 0 @ H Xh `. p x:  F  R _ |       H  0 8 Hp P ` h6 x D  R  `  M ;& K&  X&  `& H (t& 8p @& P X& hȘ p&  & 0 & h &  Eؙ & & &  & ( 0& @8 H ' Xp `' p xE  x       E?_ '  @EP X h pM  " 9. y[  E} #' Х 1c   ` Q. ( 0; @ H X ` p xEb D3 X. M  W  a  J  T  ^ 0Ц 8o. H P@ ` hl x@   VT x v.  .  . 0 u ` "  (g 8 @|. P XQ h8 p h  0 . h .  .  .  . X e (. 0S" @ H. X `! p x  {& . .  . X .  j"  ^" p / 0 8/ Hث P! ` h! x( M ;& X&  K& 8 &  &  &  & 0 (& 8 @& P@ X/ h/ p1/ x `& H t&   ح  ;/  %  ES/ z (؎ 0b/ @( Hq/ X` `/ p/ x p>   E /  E;! !  !  ! 0 8\Y H P! `/ hb! xf! }!   / " / &  / ` " " E } (" 8" @- P/ X# h0 p4      E"0 o <0 S0 \0  ? W (` 0u0 @ H~0 X `Ep x0  0 0 Lm 0 0 h 0  0  0  0 0` 80 H0 P5$ `1 hP$ x&1 o$ 81 $ J1 " \1 q1  7# x1 M# 1 #  (1 81 @g# P X" h p$ @ 1 ` 1  #  # Ȑ E˽    (P 0E@$ H$ X$ `2$ p:$ xM$ W$ l$ v$ $ $ $ $ $ p $ $ $  % 0Ȓ 8% H P% `( h(% xH =% x n R% %  m%  %  % P %  (% 8 @K P X% hP p%        LD P   %  % ( 0% @ H & X8 ` & px x-&  4& ȗ E '         0 8 H P) `9 hP x] q {      @      h (. 8 @: P XF h pR _ |       H    p  ( 06 @ HD X `R p x`  Eؙ & & &  &  & 8  ' p ' 0 8EH P `x h x     E   E <2 (%c 8ȳ @ PQ2 X2 hk2 p$ $ LD X   5$ 2 P$ " o$ " $ " @ ( 0$ @@ H. Xh `Ep x  VT  g  2  M  W  a  J 0 8T H P^ `Ц hEx  x       E  ( 0D3 @13 HEX- `K p= xZ  E )  +  > L3 VT i3 a  @EP X h p   X   LD  E  x    ( 0 @ `Ep xE   K  Z  )  +    Q 0 8y[ H Pm `O hv xd t | Q  E3 @  @  p  ; B (@ 8% @3 P3 XEh4 p  f      8 A \ p  P  ($4 0 @ HT Xp `Ep x    ) p E 7 ȸ E<4    0 8 I H P> `P hc x EL4 W X M 0 a x J  T  ^  (h4 8 @ P XEh˽ p   P E '         ( 0 @ H) X9 `P p] xq {      @      h . 0 8: H PF ` hR x_ |       H    p   (6 8 @D P XR h p`  E  x       E?_ VT (X `Epp xE   C  C ( 7 C C H y[   0 8C H PC ` hQ x ED 9   D < 7D @  SD X  XD ( 8 @EPqD XD h p;  b9  D H E˽    P E  (x 0 @ H X ` p xE?_  x E   4E  y[  E0- 8K H Pg ` hQ x8    p a NI E  x      ( 0E@?_ H)Q XiI E   Q K T h y[     $4 (CK 8/K @M PIK XW hdK pa }K ] K K K K K     EK  L (K 0 @L Hh XL `7L pAL xVT \L K  ExL @ L L L L L  L ) 0 8> HL PE`˽ h x  P E '          ( 8 @) P9 XP h] pq {      @      h . ( 0: @ HF X `R p_ x|       H    p   6 0 8D H PR ` h` x E  x       E0 8EH P ` hy[ x     EL4  @ M @ W ` a  (J 8 @T P X^ h0 p] x FM  K&  NM ( E '     ( 0 @ H X ` p x) 9 P ] q {      @    0 8 Hh P. ` h: x F  R _ |       H   ( 8p @ P X6 h pD  R  `  ߼ x E  x    ( 0 @ HEX?_ `VT pX E   E < M < M [ (M 0Y @M Hr XM `C9 pN x  5 (N  CN  _N  tN E0 8 H PK ` h xP   P  n    Z  ߼ X g  ( 8P @Q P8R X) h p+  o.  a  EP > p `  P   ( 06P @$P HR X

 X?E?E@@@@] H@f P@ `@ h@ @ @ @ @ @ @ @ @ @i1 A A (A @A HA PA hA pAxAANn A@A!A A0A)A BPaB`+(BR 0BЗ8B=XB[ `BhBJBV BBNB` BpBPBe B0BSC; C (CVHCH PCP XC YxCc C@C[Cm CC`^C C)CaDy[ DIDe8Du @D@WHD`ghD| pDaxDhD DvDlD D`{DnD EEq(E 0E8E@XE `EhE tE E`E`uE EE@wE EE`{F F(F@}HF PF@XF~xF F7FF FLFFZ F lFG GqG8G @G|HGhG pGpxGG GGGG GG`G H H(H 0H8HXHn `HhHH HHH H HH Ho H H6HI I(I@HI PI XIxI I II I` I@I I I`J J{ J`8J @J HJhJE pJ0 xJJ J@# JJj Jp. JJ@ KI K (Ki1 0K P 8KXK `KU hK K KpK KpKi KpL# LpHL PLpxL6a LpLi LpL* LpM5 Mp8M@ @MphMI pMpMR MpM[ MpMd Np(Nm 0NpXNv `NpN} NpN NpN NpO O)(OaHO PO)XOaxO O)OaO O)OaO O)OaP P)Pa8P @P)HPahP pP)xPaP P)PaP P)PaP Q)Qa(Q 0Q)8QaXQ. `Q)hQaQ< Q)QaQI Q)QaQV Q)QaRc R)(RaHRp PR)XRaxR} R)RaR R)RaR R)RaS S)Sa8S @S)HSahS pS)xSaS S)SaS S)SaS T)Ta(T 0T)8TaXT `T)hTaT T)TaT) T)TaT: T)TaUK U)(UaHU PU)XUaxU U)UaU U)UaU4 U)UaV\ V)Va8Va @V)HVahVq pV)xVaVf V)VaVj V)VaVq W)Wa(Wu 0W)8WaXWx `W)hWaW} W)WaW W)WaW W)WaX X)(XaHX PX)XXaxX X)XaX X)XaX X)XaY Y)Ya8Y @Y)HYahY pY)xYaY Y)YaY Y)YaY Z)Za(Z 0Z)8ZaXZ `Z)hZaZ Z)ZaZ% Z)ZaZ- Z)Za[5 [)([aH[= P[)X[ax[H [)[a[S [)[a[Z [)[a\a \)\a8\h @\)H\ah\o p\)x\a\y \)\a\ \)\a\ ])]a(] 0])8]aX] `])h]a] ])]a] ])]a] ])]a^ ^)(^ax^n _@(_| 0_8_A@_ H_P_BX_ `_h_Hp_ x__(' _('   I8 (M8 0 8 @i Hv P Xi `R8 hC p x f C   C C    Ȳ в ز : 9 C  < C C  =  (J 0 8( @h H P X ` h8 ph xK    ( H- гY ]   y[ _ 0] @> P_ `] f f f дg g (g 5g Ag _g 0zg @g Pg `g pg g h h 4h Dh Sh dh uh h h 0h @h Ph `h  D N h  жh h i  ; 0; ` i pi %i 6i Mi ^i ui зi i i i ; < 0` @` P` `i pi i k k k иk  l l .l Dl Rl 0fl @{l Pl `l pl l l l l m йm (m 6m Dm Wm 0km @{m Pm `m pm m m m n n к2n En Qn `n nn }n 0n @n Pn `n pn n o o -o Go л Zo vo o o 0o @o Po `o po o o o o мo o p p (p 4p 0>@>H>P>X>`>h>p>x>>>>>>>>>>>>>>>)>A>?k??? ?(?0?8?@?H?P?`?h?+p?.x?I?T????????????9?J?@P                  ( 0 8 @ H P X ` h p x      ! " # $ % & ' ( ) * + , - . / 0 1( 20 38 4@ 5H 6P 7X 8` 9h :p ;x < = > ? @ A B C D E F G H I J K L M N O P Q( R0 S8 T@ UH VP WX X` Yh Zp [x \ ] ^ _ ` a b c d e f g h i j k lmnop q(r0s8t@uHvPwXx`yhzp{x|}~ (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx      (08@HPX`hpx !"#$%&'()*+,-./0 1(20384@5H6P7X8`9h:p;x<=>?@ABCDEFGHIJKLMNOP Q(R0S8T@UHVPWXX`YhZp[x\]^_`abcdefghijklmnop q(r0s8t@uHvPwXx`yhzp{x|}~ (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx      (08@HPX`hpx !"#$%&'(*+,-./0123 4(50687@8H9P:X;`<h=p>x?@BCDEFGHIJKLMNOPQRST U(V0W8X@YHZP[X\`]h^p_x`abcdefghijlmnopqrstu v(w0x8y@zH{P|X}`~hpx (08@HPX`hpx     ( 0 8 @ H P X ` h p x                 !!!! !(!0!8!@!H!P!X!`!h!p!x!!!!!!!!!!!!!!!!!"""" "("0"8"@"H"P"X"`"h"p"x""""""" " " " " """"""#### #(#0#8#@#H#P#X#`# h#!p#"x###$#%#&#'#(#)#*#+#,#-#.#/#0#1#2#3$4$5$6$7 $8($90$:8$;@$<H$=P$>X$?`$@h$Ap$Bx$C$D$E$F$G$H$I$J$K$L$M$N$O$P$Q$R$S%T%U%V%W %X(%Y0%Z8%[@%\H%]P%^X%_`%`h%ap%bx%c%d%e%f%g%h%i%j%k%l%m%n%o%p%q%r%s&t&u&v&w &x(&y0&z8&{@&|H&}P&~X&`&h&p&x&&&&&&&&&&&&&&&&&'''' '('0'8'@'H'P'X'`'h'p'x'''''''''''''''''(((( (((0(8(@(H(P(X(`(h(p(x((((((((((((((((()))) )()0)8)@)H)P)X)`)h)p)x)))))))))))))))))**** *(*0*8*@*H*P*X*`*h*p*x***** * * * * ********++++ +(+0+8+@+H+ P+!X+"`+#h+$p+%x+&+'+(+)+*+,+-+/+0+1+2+3+4+5+6+7+8,9,:,;,< ,=(,>0,?8,@@,AH,BP,CX,D`,Eh,Fp,Gx,H,J,K,L,M,N,O,P,Q,R,S,U,V,W,X,Y,Z-[-\-]-^ -_(-`0-a8-b@-cH-dP-eX-f`-gh-hp-ix-j-k-l-m-n-o-p-q-r-s-t-u-v-w-x-y-z.{.|.}.~ .(.0.8.@.H.P.X.`.h.p.x.................//// /(/0/8/@/H/P/X/`/h/p/x/////////////////0000 0(00080@0H0P0X0`0h0p0x000000000000000001111 1(10181@1H1P1X1`1h1p1x111111111111111112222 2(20282@2H2P2X2`2h2 p2 x2 2 2 222222222222223333 3 (3!03"83#@3$H3%P3&X3'`3(h3)p3*x3+3,3-3.3/303132333435363738393:3;4<4=4>4? 4@(4A04B84C@4DH4EP4FX4G`4Hh4Ip4Jx4K4L4M4N4O4P4Q4R4S4T4U4V4W4X4Y4Z4[5\5]5^5_ 5`(5a05b85c@5dH5eP5fX5g`5hh5ip5jx5k5l5m5n5o5p5q5r5s5t5u5v5w5x5y5z5{6|6}6~6 6(60686@6H6P6X6`6h6p6x666666666666666667777 7(70787@7H7P7X7`7h7p7x777777777777777778888 8(80888@8H8P8X8`8h8p8x888888888888888889999 9(90989@9H9P9X9`9h9p9x99999999999999999:::: :(:0:8:@:H:P: X: `: h: p: x:::::::::::::::::; ;!;";# ;$(;%0;&8;'@;(H;)P;*X;+`;,h;-p;.x;/;0;1;2;3;4;5;6;7;8;:;;;<;=;>;?;@<A<B<C<D <E(<F0<G8<H@<IH<KP<LX<M`<Nh<Op<Px<Q<R<S<T<U<V<W<X<Y<Z<[<\<]<^<_<`<a=b=c=d=e =f(=g0=h8=i@=jH=kP=lX=m`=nh=op=px=q=r=s=t=u=v=w=x=y=z={=|=}=~===>>>> >(>HH? HtH5j %l @%j h%b h%Z h%R h%J h%B h%: h%2 hp%* h`%" h P% h @% h 0% h % h % h% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h%z h%r h%j h %b h!%Z h"%R h#%J h$%B h%%: h&%2 h'p%* h(`%" h)P% h*@% h+0% h, % h-% h.% h/% h0% h1% h2% h3% h4% h5% h6% h7p% h8`% h9P% h:@% h;0% h< % h=%z h>%r h?%j h@%b hA%Z hB%R hC%J hD%B hE%: hF%2 hGp%* hH`%" hIP% hJ@% hK0%  hL % hM% hN% hO% hP% hQ% hR% hS% hT% hU% hV% hWp% hX`% hYP% hZ@% h[0% h\ % h]%z h^%r h_%j h`%b ha%Z hb%R hc%J hd%B he%: hf%2 hgp%* hh`%" hiP% hj@% hk0%  hl % hm% hn% ho% hp% hq% hr% hs% ht% hu% hv% hwp% hx`% hyP% hz@% h{0% h| % h}%z h~%r h%j h%b h%Z h%R h%J h%B h%: h%2 hp%* h`%" hP% h@% h0%  h % h% h% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h%z h%r h%j h%b h%Z h%R h%J h%B h%: h%2 hp%* h`%" hP% h@% h0%  h % h% h% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h%z h%r h%j h%b h%Z h%R h%J h%B h%: h%2 hp%* h`%" hP% h@% h0%  h % h% h% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h%z h%r h%j h%b h%Z h%R h%J h%B h%: h%2 hp%* h`%" hP% h@% h0%  h % h% h% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h%z h%r h%j h%b h%Z h%R h%J h%B h%: h%2 hp%* h`%" h P% h @% h 0%  h  % h % h% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h%z h%r h%j h %b h!%Z h"%R h#%J h$%B h%%: h&%2 h'p%* h(`%" h)P% h*@% h+0%  h, % h-% h.% h/% h0% h1% h2% h3% h4% h5% h6% h7p% h8`% h9P% h:@% h;0% h< % h=%z h>%r h?%j h@%b hA%Z hB%R hC%J hD%B hE%: hF%2 hGp%* hH`%" hIP% hJ@% hK0% hL % hM% hN% hO% hP% hQ% hR% hS% hT% hU% hV% hWp% hX`% hYP% hZ@% h[0% h\ % h]%z h^%r h_%j h`%b ha%Z hb%R hc%J hd%B he%: hf%2 hgp%* hh`%" hiP% hj@% hk0% hl % hm% hn% ho% hp% hq% hr% hs% ht% hu% hv% hwp% hx`% hyP% hz@% h{0% h| % h}%z h~%r h%j h%b h%Z h%R h%J h%B h%: h%2 hp%* h`%" hP% h@% h0% h % h% h% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h%z h%r h%j h%b h%Z h%R h%J h%B h%: h%2 hp%* h`%" hP% h@% h0% h % h% h% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h%z h%r h%j h%b h%Z h%R h%J h%B h%: h%2 hp%* h`%" hP% h@% h0% h % h% h% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h%z h%r h%j h%b h%Z h%R h%J h%B h%: h%2 hp%* h`%" hP% h@% h0% h % h% h% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h%z h%r h%j h%b h%Z h%R h%J h%B h%: h%2 hp%* h`%" h P% h @% h 0% h  % h % h% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h%z h%r h%j h %b h!%Z h"%R h#%J h$%B h%%: h&%2 h'p%* h(`%" h)P% h*@% h+0% h, % h-% h.% h/% h0% h1% h2% h3% h4% h5% h6% h7p% h8`% h9P% h:@% h;0% h< % h=%z h>%r h?%j h@%b hA%Z hB%R hC%J hD%B hE%: hF%2 hGp%* hH`%" hIP% hJ@% hK0% hL % hM% hN% hO% hP% hQ% hR% hS% hT% hU% hV% hWp% hX`% hYP% hZ@% h[0% h\ % h]%z h^%r h_%j h`%b ha%Z hb%R hc%J hd%B he%: hf%2 hgp%* hh`%" hiP% hj@% hk0% hl % hm% hn% ho% hp% hq% hr% hs% ht% hu% hv% hwp% hx`% hyP% hz@% h{0% h| % h}%z h~%r h%j h%b h%Z h%R h%J h%B h%: h%2 hp%* h`%" hP% h@% h0% h % h% h% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h%z h%r h%j h%b h%Z h%R h%J h%B h%: h%2 hp%* h`%" hP% h@% h0% h % h% h% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h%z h%r h%j h%b h%Z h%R h%J h%B h%: h%2 hp%* h`%" hP% h@% h0% h % h% h% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h%z h%r h%j h%b h%Z h%R h%J h%B h%: h%2 hp%* h`%" hP% h@% h0% h % h% h% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h%z h%r h%j h%b h%Z h%R h%J h%B h%: h%2 hp%* h`%" h P% h @% h 0% h  % h % h% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h%z h%r h%j h %b h!%Z h"%R h#%J h$%B h%%: h&%2 h'p%* h(`%" h)P% h*@% h+0% h, % h-% h.% h/% h0% h1% h2% h3% h4% h5% h6% h7p% h8`% h9P% h:@% h;0% h< % h=%z h>%r h?%j h@%b hA%Z hB%R hC%J hD%B hE%: hF%2 hGp%* hH`%" hIP% hJ@% hK0% hL % hM% hN% hO% hP% hQ% hR% hS% hT% hU% hV% hWp% hX`% hYP% hZ@% h[0% h\ % h]%z h^%r h_%j h`%b ha%Z hb%R hc%J hd%B he%: hf%2 hgp%* hh`%" hiP% hj@% hk0% hl % hm% hn% ho% hp% hq% hr% hs% ht% hu% hv% hwp% hx`% hyP% hz@% h{0% h| % h}%z h~%r h%j h%b h%Z h%R h%J h%B h%: h%2 hp%* h`%" hP% h@% h0% h % h% h% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h%z h%r h%j h%b h%Z h%R h%J h%B h%: h%2 hp%* h`%" hP% h@% h0% h % h% h% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h%z h%r h%j h%b h%Z h%R h%J h%B h%: h%2 hp%* h`%" hP% h@% h0% h % h% h% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h%z h%r h%j h%b h%Z h%R h%J h%B h%: h%2 hp%* h`%" hP% h@% h0% h % h% h% h% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h%z h%r h%j h%b hп%Z h%R h鰿%J h頿%B h鐿%: h逿%2 hp%* h`%" h P% h @% h 0% h  % h % h% h% h% hо% h% h鰾% h頾% h鐾% h逾% hp% h`% hP% h@% h0% h % h%z h%r h%j h %b h!н%Z h"%R h#鰽%J h$頽%B h%鐽%: h&逽%2 h'p%* h(`%" h)P% h*@% h+0% h, % h-% h.% h/% h0% h1м% h2% h3鰼% h4頼% h5鐼% h6逼% h7p% h8`% h9P% h:@% h;0% h< % h=%z h>%r h?%j h@%b hAл%Z hB%R hC鰻%J hD頻%B hE鐻%: hF逻%2 hGp%* hH`%" hIP% hJ@% hK0% hL % hM% hN% hO% hP% hQк% hR% hS鰺% hT頺% hU鐺% hV逺% hWp% hX`% hYP% hZ@% h[0% h\ % h]%z h^%r h_%j h`%b haй%Z hb%R hc鰹%J hd頹%B he鐹%: hf逹%2 hgp%* hh`%" hiP% hj@% hk0% hl % hm% hn% ho% hp% hqи% hr% hs鰸% ht頸% hu鐸% hv逸% hwp% hx`% hyP% hz@% h{0% h| % h}%z h~%r h%j h%b hз%Z h%R h鰷%J h頷%B h鐷%: h逷%2 hp%* h`%" hP% h@% h0% h % h% h% h% h% hж% h% h鰶% h頶% h鐶% h逶% hp% h`% hP% h@% h0% h % h%z h%r h%j h%b hе%Z h%R h鰵%J h頵%B h鐵%: h逵%2 hp%* h`%" hP% h@% h0% h % h% h% h% h% hд% h% h鰴% h頴% h鐴% h逴% hp% h`% hP% h@% h0% h % h%z h%r h%j h%b hг%Z h%R h鰳%J h頳%B h鐳%: h逳%2 hp%* h`%" hP% h@% h0% h % h% h% h% h% hв% h% h鰲% h頲% h鐲% h進% hp% h`% hP% h@% h0% h % h%z h%r h%j h%b hб%Z h%R h鰱%J h頱%B h鐱%: h週%2 hp%* h`%" hP% h@% h0% h % h% h% h% h% hа% h% h鰰% h頰% h鐰% h逰% hp% h`% hP% h@% h0% h % h%z h%r h%j h%b hЯ%Z h%R h鰯%J h頯%B h鐯%: h逯%2 hp%* h`%" h P% h @% h 0% h  % h % h% h% h% hЮ% h% h鰮% h頮% h鐮% h逮% hp% h`% hP% h@% h0% h % h%z h%r h%j h %b h!Э%Z h"%R h#鰭%J h$頭%B h%鐭%: h&逭%2 h'p%* h(`%" h)P% h*@% h+0% h, % h-% h.% h/% h0% h1Ь% h2% h3鰬% h4頬% h5鐬% h6逬% h7p% h8`% h9P% h:@% h;0% h< % h=%z h>%r h?%j h@%b hAЫ%Z hB%R hC鰫%J hD頫%B hE鐫%: hF逫%2 hGp%* hH`%" hIP% hJ@% hK0% hL % hM% hN% hO% hP% hQЪ% hR% hS鰪% hT頪% hU鐪% hV逪% hWp% hX`% hYP% hZ@% h[0% h\ % h]%z h^%r h_%j h`%b haЩ%Z hb%R hc鰩%J hd頩%B he鐩%: hf逩%2 hgp%* hh`%" hiP% hj@% hk0% hl % hm% hn% ho% hp% hqШ% hr% hs鰨% ht頨% hu鐨% hv逨% hwp% hx`% hyP% hz@% h{0% h| % h}%z h~%r h%j h%b hЧ%Z h%R h鰧%J h頧%B h鐧%: h逧%2 hp%* h`%" hP% h@% h0% h % h% h% h% h% hЦ% h% h鰦% h頦% h鐦% h逦% hp% h`% hP% h@% h0% h % h%z h%r h%j h%b hХ%Z h%R h鰥%J h頥%B h鐥%: h逥%2 hp%* h`%" hP% h@% h0% h % h% h% h% h% hФ% h% h鰤% h頤% h鐤% h逤% hp% h`% hP% h@% h0% h % h%z h%r h%j h%b hУ%Z h%R h鰣%J h頣%B h鐣%: h連%2 hp%* h`%" hP% h@% h0% h % h% h% h% h% hТ% h% h鰢% h頢% h鐢% h逢% hp% h`% hP% h@% h0% h % h%z h%r h%j h%b hС%Z h%R h鰡%J h頡%B h鐡%: h逡%2 hp%* h`%" hP% h@% h0% h % h% h% h% h% hР% h% h鰠% h頠% h鐠% h造% hp% h`% hP% h@% h0% h % h%z h%r h%j h%b hП%Z h%R h鰟%J h頟%B h鐟%: h速%2 hp%* h`%" h P% h @% h 0% h  % h % h% h% h% hО% h% h鰞% h頞% h鐞% h逞% hp% h`% hP% h@% h0% h % h%z h%r h%j h %b h!Н%Z h"%R h#鰝%J h$頝%B h%鐝%: h&逝%2 h'p%* h(`%" h)P% h*@% h+0% h, % h-% h.% h/% h0% h1М% h2% h3鰜% h4頜% h5鐜% h6逜% h7p% h8`% h9P% h:@% h;0% h< % h=%z h>%r h?%j h@%b hAЛ%Z hB%R hC鰛%J hD頛%B hE鐛%: hF逛%2 hGp%* hH`%" hIP% hJ@% hK0% hL % hM% hN% hO% hP% hQК% hR% hS鰚% hT頚% hU鐚% hV通% hWp% hX`% hYP% hZ@% h[0% h\ % h]%z h^%r h_%j h`%b haЙ%Z hb%R hc鰙%J hd頙%B he鐙%: hf這%2 hgp%* hh`%" hiP% hj@% hk0% hl % hm% hn% ho% hp% hqИ% f% f% f% f% f% f% f% f% f% f% f% f% f% f% f% f% f% f% f% f%* f%* f%* f%* f%* f%j f%r f% f% f% f% f% fH|$0E1SH|$(uH=FY YH|$8ZH=+Y >\LAL-Y !LH-HX H1H5H;NLHX L1H5cH;NDAWAVAUATAUSHHdH,%(Hl$8HeHX eHsX Nl HUX 1@v HHMH=*X 11H5-H=X !H=X L%8LH:L1Z(H=W DH=W 8!H6ܟH=W H=#HHtH5HHtZH}I艾HBW HHHLl$HtaLmEuCH HwHjE1LEtEuHEHDH:Et$ALm~H5=LAt>H5#Lt+H5LtH5LE1AH5LAt>H5׏Lut+H5ϏLbtH5LE1LAAtEt`H=EEH H9 HM[LH=6bEH=VEtaf.f1I^HHPTE11H=/ f.@H=iP HbP H9tH Ht H=9P H52P H)HH?HHHtH HtfD= P u+UH=: Ht H= 9dO ]wAVAUMATIUHSvHtyHEMtlHHtdMt_DpPALQA9HSXHCdCd;C`}mHcChIE[]A\A]A^1111E1@蓚HH=A1Ҿg1:[1]A\A]A^1111E1fHUHCXIEf.+HH=`A賮1Ҿ1:萩fDH\H=(A{1Ҿi1:X[USHHHHHt^HtYw$1HsH[]1111fDM`1҅~EduHHEXHu8;HH=p@í1Ҿg1:蠨H[]1111f.AUATIUHSH7HHMHDkPAt]HA9tPH{HtG11ΒHHtfLHH߅{H[]A\A]1111KHH=?Ӭ1Ҿ1:谧H1[]A\A]1111HLH=8?苬1Ҿg1:hfDۚƗHH=>N1Ҿ1:+vfDAWAVAUATIUHSHHdL,%(Ll$8IªHHMMDpPHAtHA9tL H/LH=C>薫1Ҿ1:s1HD$8dH+%(HH[]A\A]A^A_1111E1Ð論HFH==31Ҿg1:fDL`Ńt)Hr H5 L1HIE@`1L&HI1IIEH,L=u=k=PHD$0IH<H;莾E111HL\txCHHtk1ɺHHHI H|$0LH|$IuH|$`LHL@HLH|$0I}f.[#Ht$0LHD$0`tbH|$0t)H{0H|$0ILHӼHs8HS@H{0HI}Ht2I}q=Ht$LHD$tLt$LcHD$ HD$(HD$0L M1LHL$0HT$(HHt$ mkH|$(H1Ht 8'͓HH=;U:112I}fL@HH{(HjHsH=::11ϢI}&111{H1̷HtH|$0tLH|$0HwyH{LLLHPHt$0L賫H LpLOHL褺x臒HH=9:11I}CHAUATIUHSHHHI$HMtLH!uMHt(HLmH[]A\A]111@H[]A\A]111f.H1[]A\A]111D111ff.AVAUIATIUHS֤HHDpPHAt?HA9t2LL tH;LLH{H[]A\A]A^HH=H8蛥1Ҿ1:x[1]A\A]A^1111DːHH=8S1Ҿg1:0fD蓐HH=7H71:vff.AWAVAUIATMUHSHHHL$L$LD$ dL<%(L|$8L$hHHMHMMH>D$,CP9ULC`SdI$II~9CdH@|$,uQHD$HtGH;tAHHHLHD$+H|$HH;HHH{HtI$HteHt$ H|$xNH{ Ht IHt/H{(Ht IHtH{HHtB{Hu:fDI$HI$I>II?՞I1HT$8dH+%(HH[]A\A]A^A_1111E1E13H *H=h5転1Ҿg1:蘝fDH{HHHLJHHjHI$HhHCXH-HD$8dH+%(HH11[]A\A]A^A_cH</H=41Ҿ1:ȜH1&H>HD$ H|$9H|$HHD$HHT$=uHt$0HKH|$0蟚H|$01HHHHH53eH>]H=31Ҿ1:ʛ0H qH=e3踠1Ҿ1:蕛17HkH=)3|1Ҿ1:YV迋HYH=2G1Ҿ1:$!芋HcR d@SƞHt1@dHxXH^HCX[111f+HH=`2賟11Ҿg:萚1[111fDATIUHSHH5n2HH=D dH%(H$1MMHLH=C H5T2HHH 2HD1HH膃H=C H5B2H1H6H=wC H5?211wHL%~DHH=8C HHۗ9}H=C L1&@H=C H5 g1 H$dH+%(ubH[]A\1111@H511H=B H5J11fDH=B H5111AUMATIUHSHH聜Ht$HtHLLH[]A\A]H$lH=(0{H1Ҿg[:]1A\A]Nff.SHHH3H;H{H{ H{(H{X臊H[0H5/鲟fUSHH讛Ht9HHtHyu1H}7H]H[]111Ð HXH=@/蓜11Ҿg:p1ff.USHHHt9HHtHu1H}H]H[]111Ð{HTYH=.11Ҿg:1ff.UHSH莚Ht9HHt HtUH{LHkH[]111fDH`H= .s1Ҿg1:P1ff.UHSHHt9HHt H9tUH{tHkH[]111fD[HpH=-1Ҿg1:1ff.USHHnHt9HHtHHHtQH} HH] H[]111f˅HDH=-S1Ҿg1:01ff.USHHޘHt9HHtHIHHtQH}(踕H](H[]111f;HtH=p,Ù1Ҿg1:蠔1ff.USHHNHt9HHtHu1H}0H]0H[]111Ð諄HH=+311Ҿg:1ff.USHH辗Ht9HHtH艬u1H}8GH]8H[]111ÐHH=P+裘11Ҿg:耓1ff.USHH.Ht9HHtHu1H}@H]@H[]111Ð苃HH=*11Ҿg:1ff.AUIATAUSH蕖Ht@LDH`HHtXH{HHkHH[]A\A]1111H$H= *s1Ҿg1:PH1[]A\A]1111ff.SHtXP[111sHH=)11Ҿg:ؑ1[111ff.S脕HtWxX`[111HH=8)苖11Ҿd:h1[111fDÁHH=(K11Ҿg:(1@SHtXh[111cHH=(11Ҿg:Ȑ1[111ff.USH5pH5H(HHHHEHHtnEPHtbHH 4HHPHH_PL gL;ZYt%HH5H菙uff.HH1}HH[]1111E1E1fDSHHt莓HHtqH[}AWAVAUATL% ULSHdH%(H$1D$THD$XHD$`HD$h趺HD$\IH HD$0E11H/ D$HD$@D$<D$DHD$HD$ HD$(HD$ wHcH>苻HT$TH詧uDHT$H5'H=%8 16111E11H=7 A LH-'+H|$`:HH|$h;HוHLǥH$dH+%(HĘD[]A\A]A^A_1111E1D$<ff.1AHt.rHkHHH3H T$TH|$ rkHHHD$H?wHkHD$H1跨H诨1訨D$D#˹11HD$@fD諹H蛹HD$苹HD$ LE1E111)1"1,fDKH賜HD$0H0H=5 1H5$H1H-%H=5 H5$ HP0H=5 H1HHHuHD$E11HD$H|$1qHiH|$_^f.D$T{HD$(kHD$[LH耙o;11H菻AwAeD 11H_D$HFfDHT$H5{芲IHHD$H D$(|$T7LÝH|$THD$oH1=DHt$x It$HiIHT$xHHH)H9~HH LHD$xDHu]H|$H=3 H5"1H=3 πH|$1裥H蛥1蔥LHtH|$(H1BHHH|$H|$H賽HHD$覵HD$H1HN~Hc؅HLhHsID$H|$H$H$~H|$H\$xHD$ID$HD$XLvHL$XHT$x1LDl$LHl$ IՉHHD$Ld$(:9L(11HHL9LHHt$p1H)H\$p/H|$IBM<LAǃvmdID$Ld$HXLc(L蘆9^LH\$XHl$ Dl$LLd$(HT$xH\$D$@HcHD$xH9t$HH)H|$HHD$x9FƅEHt'HHt$XHL$ T$yT$HL$ 9D$=HL$XHT$hHHt$`LD$xݢDHD$HD$XID$HD$xID$I$0H=/ H51zHHH HH Hl$H`1LWHH5~HHD$H#HT$(H=o/ H5{HñH|$iHD$xH=A/ T|H=0/ H51:H=/ .|L$DH=/ E֮H=. |H=. H5W1Hl$ Ld$(H=. {0HD$0H5HP0$1HT$11*f.f.AWfIAVAAUATUSHHXH<$dL,%(Ll$HI)D$)D$ )D$011HPHHD$81H HHH=HH-bHHD$(1H|$8Hc?*H|$(NIH\$HHIHHHH=- %AzI$8RIT$1H5[hAL=u AILHHD$ݥIH u L9uH=, LH5 1ff.fH=, H51sfH-(?H=JHEH裊H|$(FHqHD$8HH=a, H51H\$fALd$@ff.H;HH$ujH= H5F1L$ҿH= 11ɾ cH LƄ$ѩHg$ H51HލH= H$H5 1!H= H5z 1AL$H= H5 AL$׼HD$@H= H5{ H@HP 1赼AL$H|$H襬#Ht$HL0H5 1mH$H=F HH$H'kH=( H$H51%H= H51H= H5B1H$HG H  1O$Ht$(H{]H= H51}H|$PHl*H= H5aHML$H/L$H= H$H5M1覹HrH$H_H$HH=O H5L$SH=/ H51E16H= H5E11H $H\$xLH{HLLH_otI$H5Lt$Ht$(H$ oH= LH5HL$}HLuLl$HLL蕍LH5H= H5'HHtHhH\_H$HPHtH= H51з'H)fAWMAVMAUIHATIH 8USHHT$H@HHHH茤H=] HH$H5C1L$HT$HHHH= n(H51 HLL$LL$P$P$P$$$$S$P$P$$$$P$$$$L$L$HĠH=8 K^H胑H[]A\A]A^A_1111E1E1@LHyH= H51fDH5i11fDH$1HPH= `f.H511蠵DH5@1荵ff.ffDAWAVAUATIUSHH裊H1HHIZHE11 f.ID$Hxd9ID$Hx藏HH8Vu7IHtHsH^tLL~L(fDHH5|AEH@HS1H=s 膴@LHD[]A\A]A^A_111LȟALA貟L誟AWL=AVAUILATUSH(Ht$LHT$ HL$հHH,H,]HH@H,H ]IHIMt1IEIHHHyHE1L5V fK4HtpII uH=' HH5N1.E11LHK lLfH([]A\A]A^A_1111E1DMCofIIAEE1vPHD$HtD(HD$HwL0E1lDE1ME1AfM "IHLH[ÅI AEAl@E1AZf.M1LݧHHL$HHE1ADH= H511蹱@H= HH5蚱gH=v LH51}OH=Y H51c0H=? H51IH$TH= H5 1"H= LH5WfAWAVAUATUSHHHdL%(LD$8IHL$(HT$ D$Ht$H|$0HD$ HD$(HD$0rLl$0Hl$(Ld$  AHLH褍Dt$AHD$HE11H꾎HMHE11L⾮ЫH\$ E1fDt$ADE H5A1hL軰H[cH~L+HD$8dH+%(HHD[]A\A]A^A_1111E1f.1E1f WHD$HtIcH&u2H\$E1WDH\$;fDM12HT$E11ɾHɪ~HMH\$A~ff.AWAVAUATUSHH $HL=xi fE1LL5 1H.X dH%(H$1)$`HDŽ$UHDŽ$DŽ$DŽ$HDŽ$HDŽ$DŽ$\DŽ$DŽ$HDŽ$HDŽ$HDŽ$HDŽ$HDŽ$)$p)$)$)$[D$LH$DŽ$HD$8HDŽ$HDŽ$HDŽ$DŽ$DŽ$DŽ$D$HD$0DŽ$DŽ$DŽ$DŽ$DŽ$HD$`HD$xHDŽ$HDŽ$HDŽ$HDŽ$HDŽ$HDŽ$HD$PHDŽ$HDŽ$HD$@HD$hHD$HD$HD$pHD$XHD$ HD$HD$(ff.@蛔AąPA5A|AA6wJcH>AD#A@ZA$#wDuHD$8DŽ$軉HD$`q諉HD$xaDhPfD胉H$Hu&fDH=! H$H51#HD$8E1E11DŽ$E1HD$HD$H$f.H= RH7U10U1)UH|$\H$B$H$H5zcnDŽ$@L1E1E11E1T1T1T1A\H$H$HD$8HD$H$=L5LH|$rH|$ rH|$`H|$8腪LeH<$H= H|$(RH$dH+%(pH[]A\A]A^A_1111E1E1E1E1s1ҾHOHD$(f.HD$8f;H$fD#HIDŽ$HD$hDŽ$ˆI軆H$nfD裆HD$PYf苆D$LHD$@9fkD$LHD$@fKD$0H$fD+D$0H$fD  1H\H$ 1H4H$軅 1H H$_蓅H$FfD{H$.fD fDŽ$DŽ$Z DŽ$DŽ$H|$H|$Hf$HD$8HD$E1E1E1HD$H$1H|$ 菄H|$ He:kHD$![H$Hvpf+D$0HD$@fDŽ$H$Hpyf˃H$HsNfD裃H$VfD苃H$>fDsHD$)f[HD$pKHD$X; 1H茆HH$DH$fDH$fDD$0;$(LH$H$HjL95 t H<$t_HH<$1H <Ht+H5UAHh]IHH4L qH$HHD$8E1E11DŽ$E1HD$HD$fD$HD$HA$ʁH$A$$nfDL5HLQHHH7IHHCH= LH5%{HD$H9H$E1E11HD$8E1HD$HD$DŽ$#HD$ HAH|$8OHDŽ$ H<$HHPDŽ$WHtH$MGH<$L5"HL菚IHH$HIH|H8HD$8E11DŽ$HD$HD$E1H<$L=iL5LLHH=H= LL1H5ձE1E1E1臡HD$8HD$HD$DŽ$|}&H<$HHHDŽ$ HH5H[ryH|$L$DŽ$MH|$LD$(1L$L t'H$HHD$OH|H$$$$H$D$HD$8E1H<$HLD$EHDD$8H$0HtH%IHtH$HH$uA\$0t9H<$HHOH$H H$AH<$L5HLH$HH$H$ I1AM+#IGHxNA9IGDHxyHpHH8R>Hs1_HyH[HkJ;-uHH7.D3E> mHDsHE"ADBuAH= AT$1AH53趝HD$E11H|$H$$L"H|$HD$8HtGHt$H[XH=4 E1E11H5]8HD$JHD$8E1E11E1HD$(H$11H$DŽ$L$LIfH5HxH)$ )$0)$@hH$8H@0H$8HLHx]H$8D(H$8L$ 6ILPH$8H= HHHITM9uH= LH51蛛H=w LH1H5{^H<$L=HL谓HD$HPH=3 LHE1H5{E111111HL$8Ht$$5H<$L=HLOHD$HZH= LHE1H5E1E11͚Ll$8E1A+HL[H$8(?H=| LH5j1胚f1w%AT$H5H=D 1UDŽ$,LH5H= *HD$E1E114H= LH5H= LHH5(H= H5sΙH= 1E11H5@E1诙HD$8HD$HD$DŽ$SH51qEH51TRH5`1?̹VH5<1*H50iH= H51H$H$HHZH= AT$H51ØAT$H5ڰJH= AT$H51蓘|$HL$t3|$H1LÃ^|$HH$Ht11HHp HY|$HH|$PD$0$ ȉ$t+H$4$&$$H|$L$`PL LÃH|$XH|$XH5AxtH5Lxu Lt$X]|$0E$|$HdH|$p2H<$HHHOD$0E1L$$H=? L$11E11ALҊH5 LYHT$P1LH= M%H|$xH|$`H$H=O H5P1Y$oH$HH1Ht$pH<$襒H$H_HD$HkH$HKH$H$8$$pmH$H1H$@H$H$HH$H$PH$H$XyH$HH$H5l?4HH$`DRoHD$pHZHE1b1H$h$ $$tH$`HD$9HroHXIt,Ht#H:w@H,Hs߄HEIL$HH$x賉H$xu9H5rHuuI|$%_IH $CPAAj$H$xjZYuH|$pMoH$DL_1;E11H= MU H51ɓL{HHHLIH= H5\1荓Ld$pHL~HeJH$P$@j$P$LP$h$xt$8$AT$Pj$$$$P$$ $AWL$pL$H$H$H$]L牄$HĠmH$HCL@^19؃D$0D$p1D$0H$H$D$pL$$H$HH$H$Ly$H$H$H$H$H$8 IH( |$H1 H= H51近L]HHHT$ LH= H5J1{11LzIHH$PATj$P$LP$$(t$8$AR$L$P$P$`$$$P$$ $AWL$pL$H$H$H$B$0H$hHĠkLO$)H\$@HH$D$pD$H$H$ATH$HR$QAV$LQP$$Pt$@$$P$ $$$P$$$(AW$h$$L$L$H$$DHİE1ID9$(XL$$H$H$J4ASAT$QS$LQP$$Pt$@$$P$ $$$P$$$(AW$h$$L$L$H$$DHİqH=Y H5c 1D$0^H$5H65D$PH|$W:L$P9lt$PH|$=eHHBqHHGHI,HL$pOЍTHcHH1A H54  A TA  ALTH9HL$xHHL5HHπMHL*`$uHHMHT$0H= H5j1覉[H= H5;1Ll$`臉H$H5k1lE1MH=E H51OH=. H5818H$l-H$H|$\HtyD$0H5ߤ11)dL衉fH51ΈH= H5-1跈1cLhH= HtLH=p H51zH=V H51`E111H=5 H5AH|$Ll$`H$7tlH$H$L5HLHT$0"HT$0H$LH= H51踇$H|$hL$11E11AL{H$LHPJHT$h1LH= H<$H5H#HD$0HH111HHH$H $H $BH$|$HHHHvIHH|$8TLH:hH$LL$H$LH$H$!1H$H\$`1L$PHD$pIGHx59IGHx`IH8Ru,HHIt$HIt$H|$p D$PZ\H$1cEH$Ic1H$MoLHOLHT$PH= H5H~H<$HiHӱH$HH<$H`HZHD$xHT$PH=L H5X~H$FxIHH= H1H5N"~H5uL7H= H5K1}9H<$HH HD$pHHT$XH= 1H5R}H|$ptEHT$pH= H5H1}gH<$HKHUHD$PHLH<$HnHHD$pHuH<$HH HHH5U^$E1LL$D$$buAX]Hp]HHHE11E1qH= H5H1yYQ芟BAE11E1*fHT$H=\ 11H57AE1E1XyELH/,H$8dH+%( HHD[]A\A]A^A_1111E1E1DWHD$D$ D$AuDAeDLE1E11`]E1EELA8A%DADADkVHADD$$$@1[1f+I3HT$(LH%IHt1L{H=HuH= E1AR1L|Lh=Htϋ|$t$ HD$HtHLKHtHL@LBHHnHEaIŋ $1HD$0H\$H$/D$H4$Hߺ9H= HSLj&9SLXQHHtۋT$$tH@H= D%=HHA1HH5_vYH=C H$1H5cGAvH$H=& H5k1(vL%9LPHHtDHHtgtHH= H5NHHHHD1uH5L.-"L1!]IqH=x 1E1HH5rtuHl$ DH51TuNH=0 H5 =sB "HH01H= PL ^AH 5PH H51ATiH L:ff.@Ht{ATUHպSH蒽IHt@HHLt#i[]A\1111E1E1fDi=A 21[]A\1111E1E1D1111E1E1@HH7H= L ]PAH >H PH5"P1 hH 1fAWAVAUATUSH(dH%(HD$1HHA,HiXIHHH11H57Lt$g6@=5v`HHjH52L1igH9FHAHIqgHEA=uL'LHt$H|$HI%H5L1fHt$L|$I}LH5A1fE11LHLr#DD=? ff.HD$dH+%(*H([]A\A]A^A_11111E1E1DLH5L1=fH5"L1ff.HAH5׾L1e1LL  ? H=~xL22f=> #HHH= L .PA H H PHH5P1neH D~HH JH=9 L QA H QHM t$ H5P1eH BD4HHH`HDxfHHH=ƿ L ZPA H H PHH5[P1dH fHHH=v L IZPA H H PHH5˒P1[dH 4ff.fAWAVAUIATU1SHHHT$IMbAHt =/= UA~=< t == ) HqTIH$LlHE1Eff.DH%>< IƁttt!tH< H=8 H51Bc=g< L0H0H[]A\A]A^A_1111E1E1ÐHLE9u1; wfLLYu; [fDAA9#~fDHH= 1L (AUA` H HN t$H5[UmbH Ah|f.HH?L XAo PH MH AUH5 t$ H= 1 bH HHH=޼ L j^PAc H H PH5P1aH fE1x1q=: _HHHAg HDHL 0Wt$H H, PH5ԐAU1ff.fAVIAUIATUHS'DDeH]A,tq$0HBD` uaHI9rI)I(=: oE)k oE)o HE | Hm I9H]2fDI)I(wH ( LHH!B0HD#IHA,tw/HBD` t$I9u[L]A\A]A^1111E1E1DM[]LA\A]A^1111E1E1HH= 1L \UA& H H j(H5&j(_H H _ LHH!B0I]@HtcUHSHH uH[]1111E1E1@8t؃=8 51H[]1111E1E1fD1111E1E1@HHH= L TPA 1H $UH H5S^H 1f.AUATUSHhdH%(HD$X1H}HHIHt ZH޺HIWÅtALHL1AHD$XdH+%(uaHh[]A\A]1111fDLH'fDfHѾPHH+MHH^.DAWAVAUL-u< ATUH-" SHHdL$%(L$AH58< H>tLH>uAH]HHuAWHD$L5" L%HD$ff.H5; L> H5; Lj>AF0t$ - у $ )AF \$-Hƒ5HH@HH HL=5 H LM,0@LLH- .LHHI=HTM9u8\$HD$f.MfIM=55 1H$dH+%(Hĸ[]A\A]A^A_1111E1E1f.L-4 Hµ LM|L,HLL=# NLLHH]HI9u 8\$MfIM.DHH7H= L PRA H >H ATH5P1 [H HD$Ll$H<$u}AF l - NHL$Ht19HEHD$T$H ILl$HHHT$YHM&M.ZfLd$PI1QHLIA~ -Ld$8Ha HD$0MHD$\$MfIMT$H MfILl$HЍZL(MnLl$LH IT$H MfIHЍZD(M7cfM0<$Ll$tLd$PI1QLHyHA~ -Ld$8HX HD$0ttL=i2 H2 I.LH$SLl$M$MIH$+fDLLHLHI輑HeM9uLl$1HD$@Ht$0H \5|$ A~Ll$_8LHt$( H9IHLHHD$(8AF pN1M(ILH=މ1wDH l@H6M=0 HHH= L vMPA 1H 50 H H5؉A6WH |Ll$IH=B H5ۉ1LWDILH=҈1''o H5:H=8AWIAVIAUATUSHHHT$dH%(HD$81b?HH:HL% HMLH֯1uIHYHHH1ҾH= HH=g HD$0HT$0Ht$(1H5 L3 L TZYHt$(H(5H|$(AVEHL$01ҾXHHE12DHu0YHHHD$(HbAHFD9ML`HHe0H}HIC;=. .1ɺiH"H=n. lMt LHl:H= HH ի H5. HCIHA1D@L~/HD$(HEtH1ҾHAŅu H|$(nUE1L@9LEL ۭH=u H-v LD- gLD$1HIL HDxLH H=. яHH 1HHHHqH D= - H=ܫ Ht:H=ǫ `*=, H5 LHIDtUHD$8dH+%(HHH[]A\A]A^A_1111E1E1Ð=, kH|$0YfH1@L-#H ?H HH= 1L OAUAH5xAUAURH M3HDHL-1H= AUH تH AqAUL (OH5VAUHL$8HT$0RH= H HT$HL$HtH=k =+ 8=u+ HH2H= L GPAH 9H  PH5P1RH @1E1{fDHHH= L GPAH ީH PH515 QH I@L =* GHHrH=a L MPAH yHM PH5ŅP1EQH @HH'H= L PAH .H PH5P1PH =* HfDHHH= L PAH ƨHPH5ʄP1PH M=) ~HHoH=V L )FPAH vHJPH515B =PH QHH#H= L EPA1H (5 HH5߄5 OH H=Ī H51Od @AWAVAUATUSHH(dL$%(Ld$I5 XH=ɨ HH= *H5٨fHHt5H= HHH HAEH=Y [=@( H-O HtH:HH߉] tyH- HAH= L=D5 LH1MMHDILHhHtHHx Hh1HT$dH+%(H([]A\A]A^A_1111E1E1DH=x :H=c HH; H=C H8=' ~HHH=Ǩ L CPAH HPH5CP1MH :f.HH=Ц ZH= HJHD$HT$Ht$1H5 Lt L ZYHt$HH|$M=B& p19H|$f.H= H= =% WHHH= L pBPAH HyPH5ɂP1LH H HH= OH= AmH=x SDH=X t =K% H= HtEH Ƣ H5 HlHHwHH5HAEXH= \ H= HyŅ=$ HHqH=X L +APAVH xH4PH515\ ?KH fDH= H= =9$ }HHH= L qGPA)H HPH5)P1JH 6¾"HD HDfH= Ho[S=# HHUH=< L @PAdH \HPH5 158 #JH f.HHH= L zFPAH HPH5P1IH fH= H- HDHCH- Ht$HHZ13HHGHT$HHpH'` H|$6¾!HQC=%" HHH=ɣ L >PA[H HPH5m15͡ HH 7HHH=v L I>PA9H HRPH5zvP1bHH 1 H|$]HH/H= L DPAGH 6HPH5*P1HH f=! sHHH= L =PAH ٟHPH5}P1GH ,7AWAVAUATUSHHfoL5M dL$%(L$IHD$0)$fHD$8HD$@)$)$ )$0)$@)$P)$`)$p)$)$)$)$D-c H=̠ HDŽ$HDŽ$)$)$)$)$)$)$ )$0)$@)$P)$`)$p)$E[HHL$0Ht$,H1jjHD$XPLL$HLD$XH AŅ|$, H-t u= 4  H@AŅMHL$81H ; H= >5H=v p Ht$0Hk =  H|$0E1& HYH|$8' HGH|$@( H5H$dH+%('HĨD[]A\A]A^A_1111E1E1E1E1DHno serveArH= H$fD$vHvH=i HH= H-.HHL D:ApPHHH5~PP{ = 3 H|$0H-df1fHid-it-dH$H$])$)$)$)$)$H$DŽ$H^  AŅ= ~DHAHH= HL T9PHH5PP1zCH fDH|$0fDH=P H-n=p vE1LHP@L- M EuAiA}rAEH=  HtH V AŅ H= HtH  AŅ H= HtH  AŅH5T  H =y O H=ϛ t =b  H=  =G U H=  = : H=J = oH= HtEH H5 HIH?HHLAEL-O H=X MH= !H=A H& X=m L- H Mt`L5]H=6 LM11LHH$H<$I|MuHLLAAETH= Ht-H1zIHV HH+C 9  H=ޘ Ht=HҀ0IHHH&LH$,  D5 E 8 t H>:  9 H :H=m H ( N H = H5HD EH=y Hj  H H(2IHH=H蝡LHB Ht$0LH HH=s IE HD$0HD$0IE;IEHm1M HAER=I} HIECH5ZqHLHAŅH=4 HD$H. H5F H= H -HxAŅ=b  H  Hn=; H=ݖ |H=W H5 H= H Hf -JH= H5 HH=ޕ = 1IHS!HH!L"c 4] H= 5VL= ML H=ȕ L5)H֗  LL\$H|$$Ӱ4$MMH1LHD$H|$I{xL\$DL MLH" H= >H=ܔ 0={ H<L 1AUHPAoHH5PPvf.t$(HH5 HtHxeH5ɕ HtHIΓ A>/IFH IEH$H0HEHH/PLL$H1LD$@+L$-f kEDH<= THHL r(APHH/H5PtPPHL-H1AUH=g L .A%AUHqH5BrAUS2H f.HL-/H1AUH= L .A!AUH!H5qAU2H f.L- MP= VHHL t'ASHH59rPRH(H= *=  HHgL ('APHHH5rPPH= H=y H=[ 3 =0 L-ARA1AUH=ԋ HL ]-AUHH5rAU0H Ef.H5vL¸= PHwL 8&HPAFHH5kPAUH= HtH= C =a  H=g t=: t =A H= t =*  D= Et = H=o t =  H=H t = ( H=) t = Y = 9= : uUH=& tK= ~BHVQHH=A PL +AHPH4uH5vP1%/H =6 r t =/ W 7= H=2 H= = PHHH= PL "+AHRPHtH5vP1{.H H=  = HA/HH=- H0L *PHH5XyPP1.H HL-H1AUH= L q*AAUHoH5jAU-H H= t =  H=y = @=  H= = HaAWHH=K PL )AFHPHyH5?zP1/-H H= Ht=/ L=2 E1H= J(HD$HHJLt$P1AE1L1L H5Ȇ LHI HtH= HL$HLH HtH= HL$HLxUHt$HHLH#L=Ԅ  M=P HL !ARHPAHH5zPPKH= = _PHL !HPAHmH5pPPHك H}H 1 H= *H^AVH=K L 'PAH5&t1RHQH3+I H _h=A  Ń  C= |HݩL WHRAH52nRHPH= H=ƃ == o  QrH= = H=~ HcL-BvQAHH= AUHL AUHH5%nP1 *H H=с =  H=ׄ RL sHAUAHH5JnAUAU$= H=d I  HAPH=w HPL %AH/PHgoH5pP1X)H = =k H,VAHPH= L %HPH oH5SpP1(H |H%#k= bHçL AVHPAjHoH5vPPH=  H=s H=E H= H= 1H= #=r H3RA8HPH= L $HPH5sP1 ( H PHHH=؂ PL c$AHPHmH5oP1'H H= = PHHH={ PL $AH6PHnmH5oP1_'H PHHHH=4 PL #A@HPHsH5sP1'H  tO=/ gPHHH=ہ PL f#ABHPHNsH5sP1&H = %= !PHHH= PL #ADH:PHrH5mP1c&H H="~ H=l H=~ H=p~ =~ H  H= H=~ kH=T~ nH 11aIH7HHZ=  H5 H|$HE1!LH|$0PHQHH== PL !AHPH0kH5jP1!%H PH HH= PL !AHPHjH5RkP1$H HģASHH= PL 9!AHiPHjH5ZkP1$H H|ARHH=f PL AH!PHYjH52kP1J$H H4AQH=! HPL AHPHjH5kP1$H _H=)} H5 H HZ= MHL oARHPAHZH5mPPHuH={ H{ bH= HOASHH=9~ PL AHPH5lP1$#H H5Q{ HH<| HsHd{ Hc= pHѡL AWHPAH}H56kPP MuVaDE1M111EIHt^HLLMLM)aH5̓LIwuHa¾@LbDHtxE1111MIMp= mHΠAQH=| HPH{L {AAVH2H5pP1!H $:LHmcPH_HH=K| PL AHPH>gH5wgP1/!H HAVHH=| PL AHPHfH5gP1 H PHПHH={ PL GA>HwPH/mH5mP1 H LE1|H|$0HuAPH=b{ HPL AHPH5rcP1J H 2=x t)H=x t =S  HO=x t H=~x  H&L=_x L%ҞMuEVfDIH# L(HHAŅ L=x MLf^H=w IRIHHu= ~RH=9z L AATHHH5oAT5w H KHF H=^w L oXHL$4$M1LܦIH)1&H=!w (= ~HAPH=~y HPL AH6PH5iP1fH == HCL VHPAHH5aPP~PHHH=y PL AHPHcH5eP1H = `HL QA2PHHnH5'iPPHAQH=x HPL AH8PH5gP1hH H=u 1H?ATHH=)x PL AuHPH5kP1H =0 yHASHH=w PL AHPH5^k15Nu H 3= &HSAHPH=zw L MHDPH5j15u oH H=u Q=} PH=L HPAHH5aPPy=B HL WHPA HH5fP5t 9x= ]HAPH=v HPL rAH+PH5IP1H H}AVHH=_v PL 1AH"PH5jIP1RH t=i H*L VHPA%HPPeH=, HL SHPA HH5dPP(LL T= =HL _QAPHHKH5jP5r  | HL5r Mf L%stL%SuL%mH=;s LM11LHILIUM|HL?LAE]H=r _UH58 H=s HH s°AŅ'H5 H=Is H sH蚰AŅL%Xr MjDl$HD$HHD$PHD$A$DB D:LsIHAH@1LH$IHH}u = gIHH<$H5rVHt$I LLd$PHM9A$t <,WIH4$YIHH4$HA|LLLLIHZHH"A<$HD$HA$DB IH<$H5rnSI,LHD$PHHPHT$PFHLHH$L$JLҾ LLd$PDl$L=p MH1蹻IHIHLDLLwmLL4L<IHVHHuLE1H|$0F@H=Xn *= H=-n H^PQH=`q HL PA HH5iH$PH$P18H|$PH HAHH=q H L PH`H5ygP1ATH LLHD$P6ME1E1ۃ= LLT$E1L$LH<$H|$TH|$0L H5+ L = HLL SHPAHH5zfPATB=O HL AUHPA H\H5fPATI= MLE1H|$0b= ME1E1HLT$H=o L U L$APHHVH5BPPP1mH LT$L$H=l =^ +H.WH=o HPL AHPH5|cP1H = HVAHPH=n L QHPH5cP1H = LY$LE1qH|$0Hr= MHVAQH=;n HPL A<HPH5e1t$(H g=D MWHARHH=m PL A!HGPH5d1ATH ME1MHL4$L oAHWH=m HHPH5mePP1H L$= LMHWASH=SPDAWAVAUATIUSH/H0HHG1HHHL-h HMhLȼLHH=g HH5jWIHt5H=g KL{HLLAKEJH=g L-sg H=Vg Mt^L=dLL11MHILIKMHLLAkEH=f L=f MtiL dD-g Ly1DLL dMHI茖LI!KMpLH-]LH=~f JH=jf HHpi1ӛIHHHH=%f HtEH e H5f Hd螚IHHHLAEL-e Mt^H=f L=idLqL11MHI|LI!JMxHL'LAEYL-Ze MYH=:e L=sdLL11MHILIIM HL'LAEL=d MtiL HdH=d D5e L蒁M1LL #dHDI襔LI:IMALH'.L6H=gd HH=Sd Ht;H c11螐IHBHH(LA E#H=d HtEH c H5d Hc識IHHHF(LA軾EH=c HtEH Oc H5d Hg\IHHH(LAjEL%Rc H=cd Mt^L5GcL/L11MHI:LIGM6HL(LA EH=d L%b Mt^L5cLL11MHIЍLIuGMHL(LAF EH=c L%gb MtWL5bL[L11MHIfLI GMbHL(LA EC5b H*5 H+D a E a a Ha H a 5a H(Dca E>=Pa 5>a j ,a Da a tvHOgDH=a jH=a H=/ L-^a MH=Ha 8= H8+1HH[]A\A]A^A_1111E1E1fDH=a u= ~HH|H=cd L 6PAH aHPH5]P1O H vfDLhc=U ?HHH=d L PAH aHPH55^P1H @LH8*= HHH=c L PAH `H=PH5^P1uH @HHWH=Fc L PAH ^`HPH5b\P1*H LCHHH=b L PAH `HPH5z\P1H = HHH=b L ePAH _HFPH5V_1j}H @= ~WHHVH=Eb HPL AH V_PH5I_P1) ^ H ff.@Y=) 'HHH=a L PAH ^HPH5_P1H = HHH=ya L LPAwH ^H-PH5YP1eH @H_fDHC%fDHVHӭfDHfDHYfAWAVAUATAUSHH>dL<%(L$I\H_ AEt$L-AtiDd$ff.fD9}HHcL$Iǀ8-uHhLHe]KD'H)_ D9|fDDd$H4 8&H[ HHL5^ M~A>L;5_ = 1LoH^ HHH- H5__H0HL-Z 蕰HH\-HH=I^ LHHH=^ H9uAƋ7 <AAH=^ 1E11H5MAfH5kHuKD'H @H5\H1K|'1  K@HjH ZL5>^ ME1H=^ 11Ҿ H"HP"HHH] HHH; DLHL%H-H\ ;I|JwHcDH>fD=D=~#gwIcL>= ~BHHOH=6] L RAH VZH5ZRH P1"H H7\ H=\ H5K1fAE11H=[ =H=Z }=H=Y q=H=Y e=H=Z Y=H= Y M=H=Y A=At H=[ H=[ HZH={[ 1HH=j[ =H"H=V[ HqH=B[ eHt1H}L%BYSLH}TLHocH=W 胯HkH=Z / H$dH+%({&HĸD[]A\A]A^A_1111E1E1E1E1f.H= D= rHHaH=H[ L RAH hXH5XRHP14H +1A4* W  HX HtH11膦HHH=Y  1H=Y H5Ȋ H=W W W = &H=W  H=lY = DE1AVEAG=a /HA"E1H=Z H~L APH WHPH5-P1H /H5U D$~@A>Y1LA衉HW 萉HyW H`W nHGW r]H.W aW R=H> A,H% 0HV  HU HU )fˈHU 躈HU IP w = 7PHG|H=.X L PA H NUHPH5WP1H ;HW ?*HV .HV HV HV  = |PH{H=sW L FPA H TH?PH5GVP1_H 8fDi U p[HU _JHU N9HU =(HU ,U U tU H[U نHBU ȆH)U 跆HU 覆HT 蕆HT 脆HT sHT wbHT fQHzT U@HQT D/H8T 3HT " HT HuS ]S ۅHDS ʅH+S S 誅HR 虅HR R [ w=\  PHyH=U L PA H #RHϩPH5TP1H fD HDR H+R R R ˄HQ 躄HQ 詄HQ 蘄H9R 臄H@R vHR zeH~R iTHQ XCHQ GQ 8#HQ 'HE1A1X HQ ЃHQ VO CO DO 1O O tHO xO iTHO XO H3HtO 7N ' N N  sN ÂHlN YN 裂HtO 蒂H[O \O rHN vaHN ePHyN T?H`N C.HGN 2H.N ! HN HM HM فHM ȁHM 跁HM 要HM 蕁HfM 脁HMM sH4M wbH#N fQH N U@HM D/HM 3M $ HM M ߀HhM ΀HOM 轀H.M HHptH=_P L dPA+1H uMAVH_H5N5 =H HHH=E HHtH=O L dPA31H MAVHH5M5 H HHsH=O L fRAH LH5MRHgP1H = iHHXsH=?O L PA;1H ]LAVHGH5MAU)H 蛕H3=3 HHrL AgPP5N H=N H KHܣ1H5NH \H=5K  H=M tD&K ED>M E ='M  1H=K $iK t%J J =l I@K H5J H H=J HJ H=M t =& 9D-}J Et = \H=J = DH=`J HcJ H=L H\J H=L HAƅ 5~ yD$ HD$H\$D|$(=h L%ML hU H ޟHcH>LpAH=L H= L H5|M.H=K HHcHK H5_LHQL=ItVvN= ~EHH=7LL LHDHA4 H=_L P1RHLVH5dZ_H ? LHKH=LK HJ ȊHLHHF E H=K HJ rHlOHH谌:H|$= H=J ¦H I HHt!H=I HtHtHA HHH@^ H5H H|$H+L> H=XJ HI HHH =H H=J O D$ D$ 9 H\$D|$(1ҾLE1HHD$A1Ҿ1Ҿ11̋=H  ^ t8= L1HHHLNLHHH躞ADžEDL%mDHL$PH¾PHHL$膕HL$‹ A9uHQHHD$HT$Hu= HmASH=eI L 8PA H FHQPH5YV1UQH H=8F H="F H= F H=E qH=E cp= 0HlAVH=H L QPApH EHɝPH5HP1H H=%E D-E E= !HHilH=PH L #PAvH pEH\PH5 IP1PH5GP1H pHHkH=F L PAzH DHPH5GP1H u= hHjAQH=F L lPAH CHPH5HP1H #HojUH=]F L PAH uCHaPHyIH5IP1:H H=B tT=Q mHjASH=E L PAH CHPHIH5IP1H H=hB 1= $HiARH=E L )PAH BHPHHH5ZIP1zHB H H B H!B HH=PD tM=s H4iAQH=!E L PAH 9BH%PH5 IP1H DA E[= NHhWH=D L QPAH AHəPH5 IP1H  H=C HD$8D$4}IH>HD$4D$E1HD$HD$8HD$HD$@HD$ HD$HHD$(HD$@L-NC HD$HHMjHjAULL$0HL$8HT$@Ht$HgH Aƅu\D$ 1HE1c1HiH|$8/HD$80@ jD9af.AH|$HtLl$@A}tH5CLL H5f@DH=EB Ht$H蓵H|$HIMxH=1B T$4MHt$8IH B&LA請EZD$4 HΨ D$H=A %H=A #H=tA 2HH=H=@  yIHH-? E1Ht4HH5CP[I>HFHH5BHHŃ= H1HE1ATE1HL蘯ZY~^L蚳L"HHt$8H=@ H RA(E1H|$8LE1EAoLH\$7L"HwH5eVA'LPH=A L UH+PH5kO15> H H=? = HdQH=@ L PAH =H•PH5bEP1H @H:= Ht$8H=? H 5@L-= = H|$@ LJH|$H[5< uH=< H;IHH'H=? LHH5oH MvHcL QAPP5> 1H=;> HT$H9Ht$HLH|$HHH5> H"NE4Ht$H-H5< H?HH\$H=; EH=; A= HbASH=> L PAH ;HʓPH5j@P1H H=; tH-= Hd8HrbATH=_> L PAH w;HcPH{AH5AP1AŅLl$HML%.; M= mHKHD$HH|$Llv =tsuD=tgH|$LHEtEH|$'HHH|$H HQ H=< H5E1 =1 E1H|$LAH_VH=; L=8PH<L LATA HH5qEP1H 렃=ȹ ~H_WL=8H=l; PH;L 7LPA H1ATH5DTH HH>_APH=+; L=Q8PHi;L OLATA HSH5$DP1H CE= )L%?9 MtH5;LA|E1tH^AVH=: L 'PAH 7HPH=H5=P1xH {PHa^LH=E: PL A HPH5=1t$X5H 1H=8 HD$8HD$@HD$H-H8 HH=7 L-@LRH11MHH`HHHHL$@HT$8HLLD$HĊAŅtVH|$8HH5 8 H|$8Hd9E1H|$8H|$@H|$HHE1=Z jH]AWH=9 L=.6PL Ad LPHHH5 ?P1H "= E1PH\H=8 L=5PL sA` LPHH5a>P1H 1H= ~Hf\ASH=K8 L=y5PL A LPHH54@P14H TH6 HH=s6 tH=*5 L-C@LPH11MHH_HHHH-36 HZH[AQH=7 L=4PL 2LA LPH݊H5n@P1~L%5 H MoLl$HM=| sH=[SH=#7 L=Q4PL A LPHkH5>P1 H ,E11HZARH=6 L=3PL ]A LPHH5b?P1H H5*5 H|$@H6|)H55 H|$HH6|A H|$H= HKZATH=86 L=^3PL As LPHxH59=P1H =5 {HYAUH=5 L= 3PL xJAq LPH#H5<P1H 3HT$HHt$@L)Ll$@M= GH=3 H55zAŅH=3 H?H55zA+H6YQH=$5 L=J2PL A LPHdH5?P1H rL%M3 H-q5HLHHH=h LH‹ H脦H|$HqL%2 MtXLl$HMHL蕒HHCH=* LH臤‹{ ~HEH|$@蹆H5ʰ H|$HPHXH=3 L=1PL HA LPHH5>1ATH [H螥E1놃=ޱ ~HWRH=3 L=0PL TA LPHH5=1ATqH PH]WH=D3 L=r0PL A LPHlH5=1AT,H ]=H EH5̰ HAQH=2 1L GATA H΅H5O@QH /UH HVAWH=2 L=/PL 5GA LPHH5>1ATH 9PH`VH=G2 L=u/PL A LPH?H5=1AT/H `=K [PH VH=1 L= /PL A LPHH5C=1ATH = H5.2LwAz=ү HUATH=x1 L=.PL CA LPHH5=15I/ \H |HFUAUH=31 L=Y.PL A LPHsH5\=15. =. H PHTH=0 L=.PL eA LPH!H5;P1L% / H E1HTARH=}0 L PPA H -HiPH5=1UiH L[{E1=t %H5TAPH=0 L=H-PL A LPHbH5=P1H #HSUH=/ L=-PL pDA LPHH5<P1H =ح MPHSH=/ L=,PL AQ LPHǂH54P1hH = {PHDSH=+/ L=Y,PL AH LPHsH5 4P1H 4=0 'PHRH=. L=,PL AS LPHH5H415X- H H=B+ f.DUHSHHI- +t u uH/H[]11AWAVIAUAATUHSHdL$%(Ld$MQIYLHH$Ht-txH=- LH5961H<$g1HLDHH$HtvHD$dH+%(}HH[]A\A]A^A_1111E1DHH%}H11HH=)- H5Ze51닐H=- LH5geE谢AVAUATIUS`IH1VL膬E1ɹ1I11萂IHtXHHtPLHtAHLtuL29[L]A\A]A^1111E1E1@E11H54 LE1 H!L[L]A\A]A^1111E1E1E1AUIHATIUS1H覀!+L薫LHH*~,Ly9H[]A\A]111H=+ HH5}?1H=+ xH1[]A\A]111ÐATUHH5D~S草HtHI1HLH蘦H9L[]A\11fD[1]A\11DAWE1AVL5-AUL-NATUSHH|$H|$D9}fH|$D1aIA@LKH=* LHɫH=z* H躨H=k* L諫L9H|$AD9H[]A\A]A^A_111AWAVAUATUSHdH,%(H$HHDŽ$xHDŽ$HDŽ$HDŽ$@HDŽ$H$IHDŽ$H$IHDŽ$DŽ$dDŽ$hDŽ$lDŽ$pHD$(Mt MHD$p1E1AHD$`E1E1HDŽ$HD$(HD$ HD$HHD$PHD$0HD$@HD$xHDŽ$HD$HDŽ$HD$HD$HD$hHD$8HD$XHDŽ$HDŽ$H=j( }uH$Hc1yH$lH${H|$@EH|$0;H|$pH)H$HHHH$L蟶H$H|$xؕMt%I~ǕLMvH޺賅MuH|$(H0͎LUH|$PKH|$HAH|$ 7H|$]H$H$H$H|$xH|$xH$tH|$hH|$XH$xH|$8jvH|$`.HH$/HӄH$H$dH+%($HD[]A\A]A^A_1111E1E1E1E1fDH=A@E1E1訕H1H H{HDŽ$H$H,JH$HD$pHDŽ$HDŽ$HDŽ$DŽ$XDŽ$DŽ$TDŽ$DŽ$PDŽ$LDŽ$HD$HHDŽ$HDŽ$HDŽ$ HD$`HD$ HDŽ$HD$HDŽ$HD$HD$DŽ$HDŽ$DDŽ$@HD$XHD$PHDŽ$HDŽ$8HDŽ$0HDŽ$(HD$hHD$8HDŽ$HD$0HD$@HD$xHDŽ$HDŽ$HDŽ$HDŽ$P|QwHcH>= = =D=@ #wuff.1AHD$`E1HD$(HD$ HD$HHD$PHD$HD$E1HD$HD$hHD$8HD$Xf.蛫HHD$X=FmHU4H$H1HD$`E1HD$(HD$ HD$HHD$PHD$E1AHD$HD$HD$hHD$8HD$X5DŽ$LDŽ$#8ff.AH|$PtH|$PH$֝nH|$`H$ܛTH|$XtH|$XH$躛2}$HD$H H|$x $) H$ HD$@H D$0^AAe${A(LH$11H$n9A@ D࿉D$P$L$`H|$hH=! 1H5E\($`At DŽ$dH$H|$ptH$HD$HH\$HH8Hu4fDH$HH{HHLG)1ɺ1GIHuHD$`1E1HD$(HD$ HD$HHD$PHD$0HD$@HD$xHDŽ$HD$HD$AHD$HD$hHD$8HD$XWH= H5(1ff.H= H$H5x1H=G 1E1E1JE1HD$`HD$(HD$ HD$HHD$PHD$HD$HD$HD$hHD$8HD$X:H$pHU8H|$8tOHjH|$@H|$@HH|$0Ht$8H|$01贡HD$8襡HD$P 薡H$脡H$ rH$H$Q1HH$H1H= H5&H14@ H$nH$H$HڤH$HzH$H$$H|$p裠H$H蓤HD$pHzH$H$kHcvfD$o:IHt^H|$@H|$@HDHD$8HHEH|$0Hl$8Ht$8H|$0HD$8ʟH2轟H$ 諟H$H|$x:荟H|$xH谀c$ HD$8H H|$0EAH|$0pB8)HD$HHt9tVH5$$\I;$\HIGAIGMHD$HL|$HLxHHD$HHxf蛞H$h&H越fkH$d&H膊if;1ҾHfH$HD$X H$nHD$_DŽ$ ODŽ$ ?DŽ$ /DŽ$誝HD$DŽ$ DŽ$DŽ$DŽ$[DŽ$HD$DŽ$XDŽ$DŽ$DŽ$vAjDŽ$ZH$֜H$H}.fHAH$AAxH$l&H蓈vfDDŽ$DŽ$DŽ$THD$hDŽ$HqDŽ$@aDŽ$DQܛH$8?ʛH$0-踛H$(覛H$ AAA AÀA@AAAAA AAA|ApDŽ$ `DŽ$PDŽ$@=tU=.蹚HD$ xH$虚q$P菟HD$`E1H|$01&芷HD$@HkHD$@H*KHD$0H+HD$0H ˙L[11HǺ=IH H$Hz1M1AHD$`HD$(HD$ HD$HHD$PHD$蓶HD$xH{H$HODH$ $u%H= H5NL|$HMAt A_H|$81HmH|$@ H|$@HyH|$0} HD$8H|$0HHEHyYH$11H$ -O$HD$HDH(HD$`1HD$8H= H5/P1T$H̹T$HDŽ$H$t(H$11H$LG3 $AM%L1ɺ1Lh;HD$PHH|$ t(H|$ L;118;HD$ HHD$HHD$8HLEL$H$L1ҋ$pL $?IH H|$$H|$pD%@@_H|$H$蕚Ll$HD$`HD$XHH|$ $lH5CUuH5H|$KqHD$hHHt$h$l11LUHD$HC D$Eu$hH$whGHD$8H $=#=$==$- Hf.H$f[H$fP$uaHD$8L tH$H D$pHD$8XH= H5L1ڶ1HD$xHD$pHD$0HD$@$+$H=y H5L1胶HD$xHD$0HD$@$$AE1DD$`H|$ t3H|$ 11L@DL$H<8DL$HHHD$  $$KEB$HD$HH|$HD$PE1H5|LH= 11E1A苵Ll$HD$`HD$(HH|$@H=; H5TJ1E$rDŽ$hD$`1t D1H|$hD$` ‰$6HD$0HD$@H= H5T1ĴD$`HD$HDHD$@Dd$PHHD$0HHD$0HD$HH8H$H D$pH$cH=& H5I10QH5)KxLl$$u$dH|$rCHD$XHHST$`w$dH$xLDfHD$HPLl$hMt0H$xqLH5lH$xIH;H$t-H|$9H$HILFe1HD$`H=  H5FGRH|$htH= H5I1HD$HDH8D$`1HD$8DT$`EDŽ$d1tDøH$$1D$`H=O H5F苎HD$xH=. H5Fju=sHD$8*D$`Bo111D$`HT$8!11LHHDL$P3DL$PHHD$HQ EH|$8HD$PLl$8@1ԬHD$@H-H=B H5+G1LH=( H51EdoJH= H5H1M(H= H5DH1+H= H5`H1ΰH= H5DH1謰ŽH= H5DDH1芰H$(D$HL$8$DH$0$@HD$(HH H5_$P  H|$ $- HbHcH>HHD$0HpLHD$X1H5E1E1AhHD$`HD$(HD$ HD$HHD$PHD$HD$HD$HD$hHD$8H=0 1A;WNH= 11E1H5$11H$H|$`H|$(H|$ H|$HH|$PHD$0E1HD$@HD$xHD$E1LT$hH|$8z E1Ll$8LD$HLD$PHD$8HeE1ILT$HLT$PDŽ$dE1H$D$$AH|$ 4111E1HT$`HT$(HL$H|$8gH/1IHt$PdH$1I1Ht$`Ht$(Ht$ Ht$HHt$PHD$`1HD$(HD$ HD$HHD$P~H=V H5?A蒉+E1Ll$`Ll$H=, H5AhHT$hH= 11H5SE1A1HD$`HD$(1HD$HD$hHD$8cE1L\$PMH|$$HD$PH|$E1E11E1Ld$(E1L|$8A11E1E1HD$`AHD$(1HD$HD$HD$hHD$811HD$`1E1E1AHD$(1HD$HD$hHD$8H$1E1E1H= H5[A1HD$`HD$(1HD$HD$hHD$8RH|$HL$(EH$Ht$sH= H5d1蟫1E1E1HT$(LD$8EAH$xH$H|$THEtHH=* 1H54Ht$H|$5rHHHtH t$Tu1E1ZH= HE11H5AE1ժGH|$1L-MtHH$L$H$H$tH$tH=c L裆H$H$AH=7 DHτH=  H5v\H=  H$WH5d:H$H= H5pH$H$耓HhY9!HSH$HSH= H5A1艩EH=a H5蝅EtH H=@ 1H5&J$X^ 1E1E1Dx EAHD$pHt4L$H$HH$H|$PH5@HD$HtHL$ HT$PHH|$PRtnH$HtH|$HH^itaLD$8H|$11H$xELH=E H5@Q1AE1E1H5@H= [H=  H5+@FH|$EE1111ކE1탼$$L1E1S11Dd$P1HT$0HT$@$11E1E1H\$(A H=v 1E1E1O1HD$`HD$(HD$ HD$H1HD$GH=@ 1E11E1IOLl$E1H\$`H\$(H\$PwE1LL$HLL$PMLHt$8H|$DPE1҅A1E1E1F<LD$8H$xEH$Ht$pH|$kHT$8H$xDH|$ZH|$HT$8DH$xHH=_ VH5& 11E1\E1$L|$H\$HD$D$uH|$`cA#H|$Ll$H= 11E1H5 A1Ll$H|$IH5 1ĥn$ttLu5H5 ӁH= H5=軁H=l MH5 1ljH5 苁YH$H|$(1E1E1AE1L\$(AE1DE1D$H\$H D$$D$L|$H|$@|T$9y$H|$@ZH|$0HKH1ɺL$ 1H&HHyL$$p1HH$L +IHEH$MMMd$M$A9$uD$H|$LHOHHH#It$HMtLHuH1|LE1Z$D$H|$LHLOHHuL|$AH\$HD$H|$HHOHHmL|$E1AH\$HL|$1AE1H\$HH51L|$1E1AH\$HhHt$`H|$1E$薔1AE15$AH\$Ht$X1DHiI1HD$(MNL%1s HLLHH=, H52hw9$hA1u1E1E1LT$(HT$XHt$DH|$8`:H$ HtH$H|$8H1H5J贚H$HtH$H|$8H1H5(艚H$HtH$H|$8H1H5^$DHT$XHt$H|$8;\HL$(H|$XDH$IHHD$HE1E1ALT$pLT$(XE1E1E1AL\$pL\$(:HD$HE1H|$HD$PH$xHt$H|$8V:AWE1AVE1AUL-} ATE1USHdH,%(H$HphH=AD$|H$DŽ$DŽ$HDŽ$BcHLuD$`1H,KHD$D$,D$dD$hD$\D$(D$ D$XD$TD$D$$D$PHD$HHD$@HD$8HD$ HD$HD$0f.軀t'|wHcH>1D$l{BHT$H= H51E1E11E1H= ?AHD$*BH$MLML}LYD$H$dH+%( HD[]A\A]A^A_1111E1E1E1@*JDczI3uH+fDD$Tl$`@ED$Pf.D$\stH$HSfDA=DtAHD$H#{tAHD$8 ctAHD$@KtHD$D$Xl$(@l$ @ED$fED$fE$sHD$ qsH$H_NfsHD$01sH$H_Lf[sIKsHT$|Hi_@LE1E11yE1E1'DD$,D$hD$d{H$Lkt$|H L IHE1E1EDT$l H|$H|$ Ct$|H|$1DT$H sIH/$H|$ 11E1L R<DT$HH-E1LLDT$H$HD${9LHxH|$JHLIZDT$t$XCALt$DDt$PLl$ Dl$`L|$DT$,)9\$9\$9\$ "9R9$N9\$(A9tNA9utH= H51H|$f\H/H= H5H1q IH|$I'\LH$LHIătH= H5#1蔒$H=v LH51m9H|$11ҾX襋H=> H5I1=H=& MH5QnH= LtL:IH= H51H|$F[H= H5CH`H= 1H5趑L|$LI:H(L$L0:H=y HLvH=g H5i1iH=M H51OH|$L$FH=& LHvH= H51H= H5C511Lt$L|$Ll$ DT$,$H|$0wD$g D$HHtT$\D$T$D$LH8D$H=[ H5_gDL$,LD$HDT$L$dHT$@t$hH|$8IH4eLHUHHuADžAA|EGAwJcH>AwDlu?fDjHT$ HVuDH$H=- H5 17AE11E1E1HULXL~6HvL覌HD$(dH+%(+H8D[]A\A]A^A_1111E1DHiHHJkfiHD$LE1E11@pE1E1ODiI{iHT$$HU~@AjD胆HHXE11E1E1A1nEE1E1}UHH8lH8H$^H$HCHS Lr(^H$IFH:vBMH$t1H$̅HHH$LHBIH$HH$蒅IH|H$D$HBfDH9L$9t$HdH5&HH$BHD$HDH|$1112IHuAfL(H0HHtLH$HH$HHL9uH|$@VLXRD$>T$ rLIHD$ =H= 1E11H5<AE1H= 0HeH|$ULQH= H5A1趈H= 0AE1E1sE1AeAE1W111LaIME1LTYID$T$$H|$wIHtD$$tS=t;D$E1H= H51AH= /HLD$HLHD$ZXH$H= H51衇H|$wT1PH$H=h H5t1MT1fPf.AUATUHH5)SHHLgL9)HtH[]A\A]1111ÐH5L)HuVA$HDPtLkILLHxIHtqH}HSH51諆EH}Et)H51苆HL[]A\A]fH5b1bEfH{$Huff.fAWAVAUATUHSHHLt$PLT$XEIA̓ MLLT$bMLT$tLH5H1ƅLT$LH5H1譅E~QEEl$L%AE1IMtEtH5VH1rB;LH1`IGM9uHHH5B1[]A\A]A^A_8MfLLH551afDH[]A\A]A^A_TDLLT$E 1LT$H%MML1ff.ff.1: @HHI9uLH|LD$Y5/LD$I1fDIHM9t$AIL uIf1HAM9uADAtpE~5AD$L%HLtff.LH1HL9uLHH51HLN[H5]A\A]A^A_|$(t-1E1E1E1H=> H5s1E1E@H$E11ɾH6rHHIEH= 1E1E1H5?Lt$ t$xAL#H ILH$HH= LH5x?0H=w H5`?H=_ H5̳?H=L 1E1E1H52E1M?H=) E1E1E1H5dz,?f.ATUHSH H{HDPu[]A\1111SIHtH# uLD6=tH}HSH51>EH}Et[H5;]1A\s>H5b1b>EjfDAVD4AUAATIUSHvA9Hc1IcLg~{ E1I1fDDHcLAt I I9t=B+IHDPuH= H51=[1]A\A]A^1111[]A\A]A^1111fH=a H5*1k=BfDH=A H51IcH=AWAVAUAATUSH8L&dH%(H$(HH5HDŽ$HDŽ$LHDŽ$HDŽ$DŽ$t3H58LD$HDŽ$E1DŽ$E1D$HH=L=Z6 E1HDLD$PE1HHD$ HDŽ$HD$D$\DŽ$D$`D$XD$dDŽ$DŽ$D$ D$h HD$@HD$8HD$0HD$pHD$xHD$(HD$ $tg|wHcH>=F=  = =~.g#uff.f1k,ex$tT$\u DŽ$H$L(H$HtL2=; DŽ$DŽ$H|$(tH|$(H$H$ L$P$E |$hOD$P D$H D$ p  D$hPAD$XD$HH5T$ vLH5ӯIvH|$0T$ Iu H|$0rTHD$(H|$(| MH|$@Ht!H$11oL$_MH$HHD$xH D$D$XHTHVHEHD$0H$`HD$ OH$6H|$ LD$0H%H1(AL$XLHT$ uA?MH|$8ھwJHD$0H\D$E 8 HD$0Hl$(HD$@H$D$HD$8E HD$ L$H5 H$HMx LWH$D$dMH$$LHHD$H0|$\H\$H H$H$Hc1$HT$HAH$`LHD$HPB3PL$DD$`$(AYAZHt$HH$ @H(Ht$HIcH$H(M9H$L\H|$pH$AH:1…sH= H5"16H|$xGH$ H|$xH$ NAŅH|$x)rH|$  H=Q H51[6D$ E1E11fD\DH5LID$HH5L1,DŽ$D$H=D$HPHT$ H= H5b15HT$ H5hH={ 15HD$8E1E1E1HD$@D$ HD$ E11HD$0HD$(H=* H-߬6H|$,L5L/ HL HLH|$(H|$0XHH|$ H$i5H$5H|$@1H|$8H|$H$HH$(dH+%(#D$ H8[]A\A]A^A_1111E1E1E1E1Ð[H$Hk }$DŽ$uD;Ic HD$0QH=Ɏ H5X13H H5H$DŽ$H$H= H513HD$8E1E1E1HD$@D$ LfDD$dDŽ$D$ D$`s1ҾHHD$RfHD$@AHD$81t$PuD$P'D$\k D$\D$Pf.IHHD$h1Ƀ~HT$hHH€:kL$hYH$H {H$HjL$htHH9OH H$D$hPFfDD$H3DŽ$ D$`DŽ$D$dIHDŽ$sHD$xf[rHHHwL-F H$LaH$$$HcIMHID5H)ff.@HH9P t tL- DHD$(HD$pD$XD$X=GPH$H|$tE3H|$HVnHT$ H5SDDŽ$1E1[.+HD$HufqL$hAHcHiVUUUH )HcHi*H#)ȍDP)LcD$ (D$HV7$u^|$`tWH= H5.1'/D$ E1E11HD$8HD$@HD$ HD$0HD$(HD$(%D$HH= 1PH5.vAD$HD$hPyDŽ$DŽ$ H$T$hH=& H510.F HT$ H= H5H1 .^HHD$ H $ $ D$XH$H|$ H$g H3HD$8H$t$X(H$H|$8H$HHD$@HD$EDL$XEHt$0H|$@RHl$(H$H H|$(H(HH\$0H(H|$(H5 ;H5 H,E1H|$pH&t$ E1H|$xHHH1H$H.$=EH$HD$pDL$XLD$pH$ E1HT$H$H$+HD$Pn D$E4D$EDT$`Et@|$dH$vlH$%|$`H$HH\$HLl$PH$11Ҿ H+u11ҾHT$hLH?ÅD$E11ҾHD$PH\$HDD$PCH$DLDD$HDD$HD9H$11Ҿ DD$ E2H|$(a&H=R H5ݡH1Y*H|$0H=0 H5СH17*1|$ @H$L9H\$HH= H51)D$ |$\1H= H51)H$LHPAH$(PD$H$H$Z_AXZH=` H5Vl) H\$HE1E1 D$HCD$ E1E11HD$8HD$@HD$ H= E1E11H5y(D$ HD$8HD$@HD$ HD$0{H= H51(HD$E11HD$8HD$@HD$ HD$0D$ 'Ht$(H|$@HHD$0H$H\$HH|$8HHH|$ HpHD\$XEH$$HHD$HN |$`H$H5u&$Ht$HH$;$H=x H5 1'"DDH|$pH$ H=4 H5A@'L~H|$p"ALH5 H"H5 Hy$1E1E1HT$ 1ۉD$ LH$1EIH$IH/ELLHIHCHnH|$HAIH%PELHD$P$HD$HIEHT$PHt$HMHǹLHD$PH|$PH$ H|$pLcw1Ƀ$gPjDL$hHT$`H$H$ZYH$ H=R H5KH1Y%H=: MD$ Ll$PH$H$H5H= 1%H= E1D$ H$AEWH|$pH|$ |$XH= H51$H=k H5|w$rH5 HH0 H5A H-11l$ E1HL$8E11Ht$ H5 HHH5~ H-D$HE1E11ۉD$ HH$Hc*11A7H=~ H5#[H51#H=~ H5#01Ll$PD$ 2H5Ϛ1E1襼 B,H51I胼H$D9ο WH5q1E1L B, H5K1I*H$D9ο ;1H5$~;H$E1HD$HHD$HH5B(1I軻D9$տ H=C} H5f1M"H$H$YIH=} 1E11H5}"D$XD$ H$Hu@HSalted__H9$uFH$$HHHD$H;$H=| H511!+H=g| H511q!H$H5H3H$sH$ fDAWAVIAUIHATIUSHQI]HHPH߉T$ 2AT$ I~LD9Mc, IfAI_LHzH[]A\A]A^A_1111fD9~ρH߹HD))A.HcH-HHHI]@H5OD))A.Hc\IEHLH-&H߉)ʹH)HAHc,HHt I]I}JHIE1UHSHdH%(H$HgH9t*H$dH+%(uUH[]11111HPHlHH1HsH{HuCDAWAVAUATUSH8H|$HHt$dL$%(L$(IiD$]Ll$ ,HH5L1L9l$H|$:HHIHII)AIc׹HLH|$1IVLBD< hHH5CL19l$pH$(dH+%(H8[]A\A]A^A_11111@H|$11HwDH$(dH+%(uAH5H8L1[]A\A]A^A_cH$(dH+%(u H5ff.@AWAVAUATUSHdL4%(L$I`IXIPH$IMHMMIIvHD$Hu&)@LIvIHt>-uHD$L%' LLHID$$D$D$ D$X|wHcH>HT$H=v H5e1fDD$H=v LLH<$H+H$dH+%( D$Hĸ[]A\A]A^A_1111E1E1E1E1f.D$$D$!L$Pc9MCD$f[H<$H2f;LH`LD$D$ V1H0HHu#`@LHsHHt?>-uH\$H=zu H5K1HH=bu H1H51 H LHIEH&1hH ` tL1HOLH9H 1} tH B1HLHH J @tH 1HLH[= H yH 1HLH(H  tH 1HLHmH e tH v1H_LH:H 2 tH C1H<LHH L tH 1HLH\H  tH 1HLH)H  tH 1HLH~rHT$LH5ւHtWHtOMtJ uALHH5Hjt&1H LHH1H[]A\A]A^A_1111E1E1ÐAWAVAUATAUSHdH,%(H$HHDŽ$@HDŽ$@wHHL= DHE1LE1L%BD$8HD$H HD$PH HD$XHHD$HD$HD$`HD$@HD$HD$(D$ @t7/wIcL>D_  u1H|$@u EnH|$+ HD$HtHL%~IHtEHl$L%~LHIH I)1HB0賺 MDu EuH=T^  1H51讜DL$(EZ DD$ EuH5HP H|$rےHD$0H H5q?HD$ H 9"IA"Ht$XLHHD$(H H|$(HD$HG H|$(HHƝIH H|$H譟; L-H|$ßHD$H H$pHT$0Ht$ L$H|$HHD$XIH=?@HD$H H$HT$Ht$ L$H|$HHD$hL$E  t 1H$H$H|$@1HD$P!lIHT Ht$HHHm|HH@ H5 , Ht$HLHU~HH H$HHD$@\HD$8Hn L9$` H|$XLHŅF E1H|$P H|$85L6LLչL=v[  E1E1DH=[ H5ʾ1ff.HT$1E1E1H=d[ H5CJE1L%{aHD$(HD$ HD$HD$HD$HD$0LLLH|$H|$0HH|$(eH|$3H|$)H|$ LǸMtL pH$dH+%(tH[]A\A]A^A_1111E1E1E1E1ÐZ HD$(E1E1E1HD$ H|L%yHD$HD$HD$HD$0H=Y H5s~1AmDHY WH|Y ?HD$)fE%` E1Ec%@ fD 1 @ ! @@  @  @ @ @ |@ l@ \@ L@ <@ ,@ r @ b @ R @@ B @ 3 @ # @  @  @@ @ @ |@ l@ \@E% CHD$`1HD$!A^ fHD$PHD$H{HD$XkHH萻SH5yH菩#D$ f. t@ D$8\@E% D$8;LE1E1E1g1L%QvHD$(HD$ HD$HD$HD$HD$08{HD$@HD$(E1E1E1HD$ L%uHD$HD$HD$HD$0H=U H5xHK D$(JHjxH=U H51HD$(E1L%NuHD$ HD$HD$HD$HD$0U u$EAAHw.E1E1+H=U HwH5 1fH=T HnwH51EH>w$Ht$1L%ttuwHD$(E1HD$ HD$HD$HD$HD$0$H=sT H5x1}Lu=T +E1HvDHt$P1DS EH=T 8HvH5vhH5vHWHD$(HD$ HD$HD$HD$0_HD$(MHD$ HD$HD$HD$0*H=HS HD$(HD$HD$HD$HD$(E1E1E1HD$ HD$HD$HD$HD$0H=R H5u1HuH5u11HT$XH=R H5uHD$HD$HD$7H=R H5WHD$H=eR H5qHD$HD$H=;R H5ruGH=(R ;LӑHD$苻HHHt,HH5u1E1L7H=Q E1E1HtH=Q H5u1E1H|$85L薯6LL膯L='Q 1E1E1H=GQ H5H1Q1E1HL$8H=&Q H5t10H=Q 1E1E1H5t1Ht$HLH"sHHHH5r Ht$HLHrHHtSHt$@IHt'HD$PH9$uH|$hHL;H=dP H51nH=JP H5k1TH=0P H5s1:H=P H5bs"1H|$1H5sH 1H5TH1H5sHLl$HHT$P1HH5sLHT$XE1E1LLH1H*.IH|11HBkH2Ht$PH@s1H$H$H$IH=N Hl$puHH$H5K]H H$H$HH5/H$HH$H|$@ HH5rH$ H H|$PHH H$H$HHL HsH|$@8H|$PH$H=:rcL l$8H|$`H|$`w_IMtcL$LD$hLH$HT$XHt$H-:M t%t1PH=\M H5q1f6JH=5M 1H5q?=L #cZI_% 0H=L HAA~D2Aƅuff.H=sdgHiHt$(LTHt$11HL$0b_HL5bH Y1yH|$HsIH7HD$='.ILHHUIHLH1LT$DH5LKHHH1E1E1t$8HT$8HL迷ZYuuH=I H5N@A-D fDHT$H=I H5c81E11E1H=gI At1ML՘HMLH|$({HÖH|$0H5q-HD$8dH+%(6HHD[]A\A]A^A_1111E1E1E1fD HD$NLE1E11E1TI 1ҾH<H@HD$ADE1H=IH H5=UE1AH誽H=H 'H5?1H=G H511wH=G H51]~f.@AWAVAUATUSHH?t8H=G H5FpH1[]A\A]A^A_1111E1E1fDHLHIAMMtRLIMtaLEuP~PL#H[]A\A]A^A_1111E1E1f.LLH肿ID賩H=F HH51H=F ˓LCff.AWAVAUL-oATUSHdH,%(Hl$xHD$\HD$`HD$hHD$p H=HD$0舵LHHD$(HHeD$$E11L%MD$ HD$HD$8HD$HD$@HD$H$@Ktw|wIcL>=)=~ʉuHE1脳wVtuf1AYtMW LH5"I5HHHT$01LHD$HH|$HIȶMH4$HLZIMLL薠H|$Ld$`E1%DH%LHIWCAHD9Lt$8Ht$pL<'MDT$$EqH=D H51+HD$1HUHHSf  HD$8HHHD$|$$tYI@HD$@fkHD$q[HT$\HyQE1HT$(H=B H511H1E1E1H=B AHɞLQH|$pL/L'H<$.H|$hAH5k蘠HHD$xdH+%(HĈD[]A\A]A^A_1111E1E1E1fDk1ҾH܍H$cLSHt$HHBH|$0舺IH,HDLČIHH=A H51IH~I(L%,L-eDAwTAGIcL>D$ D$$LH&_H=;A H5 j1EII(HuLH)E1E11E1E15fDLL@LiL@LiL@LLwHȮfD1E1E1E1谮1H$H|$uLD$0L$$H|$`H$Ht$ItLd$`M=f.HT$(H=,@ L1H5p3H=@ 'H=@ H5h?H=? L{L_HE11E1ޭLd$`H|$0LLĉIH|$@11HT$hW H4IH11ҾHgH|$֨HIH11ҾH1D  E>H5? LҍDD$$EHt$LwHD$HFHt$LL|$ L1҉T$ Ht$11LbH責|$ D$$H\$D$ MtL$ T$\LHt$wt)L$ T$\LHt$wt@Ld$`ufD}8HT$H= > H5H1'Dk}E18ъHT$H== H5H1Ld$` H== LH5f1>H== LH5̨1!H== H5+3;HE11苫E1=Ht$11LHD$HD$\=ulHt$L"MHt$LP|$ HD$ H\$aH5<Lt|H=< H5e1HªH\$SH1詪|$ u#D$ H腪H\$M1D$ Ht$11L+QLE1E1t$pH$1Ht$(^_~MtHt$L<H=; H5*e1|$ uHH\$H=; H5d|$ Ld$`H\$H=; H5dּH螩Ld$`H\$f.DAWAVAUATUSHhdL,%(Ll$XII边D$4HD$8HHD$@HD$HHMH=KL5xE1@LL裼H$E1H-yHD$HD$HD$HD$ D$,f+ | wHcDH>fE11E1H谽LhH|$8LFH|$@|H贉L輇H|$HH5`d&H=: HT$XdH+%(Hh[]A\A]A^A_1111E1E1E1E1fDHT$H=9 H5(1E11<@n9 ^9 諼1ҾHI@L(H蠼LXH|$817H|$@m1覈L讆H|$HH5Rc1۷D$,Rf;HD$A HD$1HD$ !=DY=@j# HܻLH|$8 1sH|$@1)f=FDDDAH$H$st1$1H|$Ht$@бHt$11HL$HOH|$ nHHIM1H|$8L5xJILL+7 H5<7 H|$8t$4H|$8H4$Hh_H|$8Hct$,H|$8载B 6 T$4LH|$8yIH$Ha=6 H$^HD$HHT$@EAPE1E11PLHE1AYAZAH輹LtH|$8LRH|$@HLȃH4$H|$H5E1H8Ht$4XRL$4F@H=5 @H5͢1H=5 H5T+H=5 H5+E1.H=5 H5_1E1H5H|$8uH=T5 H51^E1LHT$PH5tL\$P H|$PH-H|$PHD$~HL$HD$HtHtH=4 H1H5r_H _H|$HH$ՒH|$H4$’H|$PH=4 H5m1QE1E11PLHE1Q^_AH=P4 H5^1ZDAVL5 AUE1ATL%EULSֵHtv w$IcL>H=3 HH5^1H=3 HH5"1[]A\A]A^111DAf.(u1MtDH=j3 H5mHHHM^HD1[1[]A\A]A^111f.AL1@AeDAUDAEDA5DA%DADAH=2 HH5]1AVAUIATIUHHS跃LH謃H}LtH5,^LLMLHHH1H}Htt H[]A\A]A^1111E1fHߺBH5]1H[]A\A]A^1111E1+HEHb1f.AWE1AVL5AULATUH-u]SH{HXdH%(HD$H1HD$@D$(HD$IHD$HD$HD$ 豾$HcH>=D=@uLd$@E1E1E1E1e@D$(fDLd$@MųLH\fLd$@H=l0 L1E1H5CE1E1jE1H=H0 LL$(1T}LL$(A"@H|${H.IH|$@H5RHHD$HrfH|$uH H|$@H5HEHD$H2fH|$oH讍ɲH|$@H5ٱHHD$HQf蛲I=苲 1HܵHHD$ DLE1E1E1Ld$@E11E1Ht$ LϹHDD$(LLLpLȠHH،H|$HƌH|$H贌H|$H袌DD$(HD$HdH+%(HXD[]A\A]A^A_1111E1E1f=ED$0Ƕ蠶Ld$@DD$0DD$KH}H?HHH[]龱ff.AUHfATUHH5(SHXH=;+ dH%(H$H1)D$)D$ )D$0)D$@)D$PHqHHH^{H=* H5WH1HH膍H=* H5WH1HFHwWt HetHOWHHEH=s* H5VW1uH=HHH8HL%6W@H{(H(HLߢtCƒt ) tHD$CHT$HT$`w HT$Ll$HHL$(LHT$ HD$0薈vLH(}H;HjH$HdH+%(uHX[]A\A]11111HHHH認H11fUHSHH>軀HӋH}H觀H迋HHH[]>ff.AWAVAUATUSHH=H3HIHH=( H1E1H5UL=L5cULH5qHiLH`AL|A9#DLH5 ( HHt HYjtH=yHHtH5 HH_ktH=' L1H=' HHcH{H=' LH1' AH1yHtH=' H1H5TH܄H=pH8HH=|HHH=mTHH5 HL[]A\A]A^A_H=& HH5S1[]A\A]A^A_DH=& HH5SH5& H=LfUHSHH>HCH}HH/HHH[]鮬ff.AWH=AVAUATUSH覉HH=&& IH5S1E1L=DL5ROLH5H]LHAL|zA9#DLhH5% HHt HtH=HHtH5HHWwtH=l% L1rH=[% H胐H軴HH=<% LH1?% AHIHtH= % H1H51R HqH=HHkH=HH|H=QHH51 HL[]A\A]A^A_CH=q$ HH5lQ1[]A\A]A^A_mff.fUHSHH>eHH}HeH߆HHH[]^ff.AWH=AVAUATUSHVHH=# IH5HQ1E1L=L5PLH5H=LH蘑AL,xA9#DLH5A# HHt HetH=F豆HHtH5BHHgtH=# L1"H= # H3HdH賅H=" LH1" AHɔHtH=" H1H5OHpH=HpHH=HTH\H=OH8H5 HL[]A\A]A^A_H=!" HH5O1[]A\A]A^A_ff.fUHSHH>cH裄H}HwcH菄HHH[]ff.AWAVAUATUSHH=HHIHH=r! H1E1H5NL=gL53NLH5H LQH0ALuA9#DL谠H5 HHt HztH=ދIHHtH5ڋHH?jtH= L1H= HˋH3bHKH= LH1Y AHaHtH=U H1H5yMTH茈H=@HH萫H=LHHH==MHH5 HL[]A\A]A^A_鋺H= HH5L1[]A\A]A^A_DH= HH5LH5 H=kfUHSHH>iHH}HwiHHHH[]~ff.AWH=AVAUATUSHvHH= IH5xL1E1L=L5yLLH5H=tLտH踌ALLsA9DL8H5a HHt H1tH=fсHHtH5bHHWtH=< L1BH=+ HSHtHHD$>hHƀHL$H= LH1 /H7HtH= H1H5JH袍H=JH~fH5ٙ HL[]A\A]A^A_3H=a HH5\J1[]A\A]A^A_]ff.fUHSHH> HH}HHHHH[]Nff.AWH=AVAUATUSHFHH= IH5hJ1E1L=L5IJLH5H譆L襽H舊ALqA9DLH51 HHt HtH=6HHtH52HHtH=  L1H= H#HHHD$辳H~HL$H= LH1 /HdHtH= H1H5HHBH=HHNfH5 HL[]A\A]A^A_H=1 HH5,H1[]A\A]A^A_-ff.fUHSHH>ۙH}H}HǙH}HHH[]ff.AWH=L=pHAVAUATU1SH ~ILH5HpL蛻fLxL o9mLH5$ HHt Hd`tH=)}IHtH5%HHʝtHH= LI1MH= LH5;1پH= H5=1ľH= H5oG1课H= H5xG1蚾H= L諄HSH+|H=d H5@FH1c5 HH=H HAH=ZFHHsH=1H|@H5ٕ HL[]A\A]A^A_鋳1LnH= H5H1趽UHSHH>kHC{H}HWH/{HHH[]鮞ff.UHSHH>HzH}HHzHHH[]^ff.AWH=L=$AVAUE1ATU1SHJ{I"LH5HpLظfDL踅LMl9L;H5d HHt H4tH=izIHtH5eHH芵tH=? L1EH=. LVH޶HyH= H5CH1 uDA;H5a L虱EH[]A\A]A^A_1111fHkHtH= H1H5C蛻HH=CHOHwjH=H3ZfDH=A HH5D1[]A\A]A^A_5DHHHH5C…H1111UHH5CSH藟Ht xHtH[]111E9HSH= H51蠺EH[]111H=i H51kfUHSHH>蛱HwH}H臱HwHHH[]^ff.AWH=L=$AVAUE1ATU1SHJxI"LH5HTLصfDL踂LMi9L;H5d HHt HDXtH=iwIHtH5eHHj^tH=? L1EH=. LVH~HvH= H5@H1 uDA;H5 L虮EH[]A\A]A^A_1111fHWHtH= H1H5@蛸HfH=@HOHg~H=H3ZfDH=A HH5A1[]A\A]A^A_5DUHSHH>{HuH}H{HuHHH[].ff.AWH=L=AVAUE1ATU1SHvILH5HfL訳fDL舀Lg9L H54 HHt H~tH=9}uIHtH55}HHj^tH= L1H= L&}HzHtH= H5>H1޶ uDA;H5q LiEH[]A\A]A^A_1111fH舀HtH=l H1H5>kHxH=>HHmH=cHZfDH= HH5f?1[]A\A]A^A_DUHSHH>蛥HsH}H臥HsHHH[]ff.AWH=L=IJAVAUE1ATU1SHsILH5H萂LxfDLX~Ld9LۏH5 HHt HԝtH= {tsIHtH5{HHʐtH= L1H= LzH~HvrH= H5<H1讴 uDA;H5 L9EH[]A\A]A^A_1111fHȘHtH=< H1H5`<;H3H=\<HH跃H=3HZfDH= HH56=1[]A\A]A^A_ճDAWH=gAVAUATUSHrH%H= IH5<11L=L5];腳LH5& H>^Lv@HX|Lb9LۍH5 IHt HtH= ytqHHtH5yHL*StH= L1H= HxL辎HvpH= LH1貲MDH5 HL[]A\A]A^A_;H=i HH5d:1[]A\A]A^A_eDUHSHH>;HoH}H'HoHHH[]^ff.AVAUATIUSH)I1HHF]IaHLLtHؗHtHHfu[]A\A]A^1111fDHLpH[]A\A]A^fSHHt#HH5h[H1IfHS:HH[HDHHD1HHH5>:AVAUATIUSH)I1HH膧I`HLLHؖHtH[Hu[]A\A]A^1111fDHLoH[]A\A]A^fAVAUATIUSHIHHIN`HLL`QH8HtH+H#|u[]A\A]A^1111fDHL=oH[]A\A]A^fAVAUATIUSHIHH֏I_HLLVH蘕HtHHLn[]A\A]A^1111H[]A\A]A^XAWAVAUATUSH(dL$%(Ld$AHD$EL5^ M1L=D @A9uk I^LLH虩HD$返H|$HMMw8I0MtA?tDMw8I0MuEzHD$dH+%(H([]A\A]A^A_11111DcI;^fLLH(HD$H|$HMGMw8I0MsA?t[H= EuD|$uuuIOT$1I0H56蘭MwMfDIWH5B1I0jMwMmvfDH52,12H= qfDHt$H=d SL5` Mff.@H= H5+1۬lfDLWH"f.LHWH5}DAVAUATIUSHIHH薐In\HLL0HXHtHkHCu[]A\A]A^1111fDHL]kH[]A\A]A^)fUHSHHH= t^HtAH= Hmu)HHHH5H[1]闫H[]11111HuH4HHHDHHDH1[]HHH5l4AAVAUATIUSHYIaHH6]I[HLLrHHtH;HSu[]A\A]A^1111fDHL jH[]A\A]A^fAVAUATIUSHIHHVI~ZHLLHhHtHSH3mu[]A\A]A^1111fDHLmiH[]A\A]A^fAVAUATIUSHI!HHIYHLL蠁HȏHtH胪Hs[u[]A\A]A^1111fDHLhH[]A\A]A^AfAVAUATIUSHyIHHI>YHLLPH(HtH裩HLPh[]A\A]A^1111H[]A\A]A^^AVAUATIUSHIHH6SIXHLLPH蘎HtHHPu[]A\A]A^1111fDHLgH[]A\A]A^鹨fAVAUATIUSHIIQHHsIXHLL`nHHtH苨HSHu[]A\A]A^1111fDHLfH[]A\A]A^IfAVAUATIUSHIHHeInWHLL萋HXHtH[HRu[]A\A]A^1111fDHL]fH[]A\A]A^fAVAUATIUSH IHHIIVHLLH踌HtH{HSru[]A\A]A^1111fDHLeH[]A\A]A^9fUHSHH uH[]111f.HHeeHH[];ATUHSHH>JQH;I?QLHyt[]A\11H}ǐH_cH;H贐HLc[H]HA\͆ff.fAWAVAUL-ATLL%{\U1SHhdH%(H$X1 D$HD$ D$,D$蔍iff.#? 1$%IcL>H5Y| L\$4uA@1 EAĨH=k H5m#1mH=5  H=H L-f,1LGH=0 H5>.12]A H= H5#1艛H= H= L1H= H5<.1գH= H5E-1軣H= H5D-1衣H= H5A-1臣A@H=a H5c"1cEA_@D$0@HT$ H= H51H$XdH+%(Hh[]A\A]A^A_1111E1E1E1E1@π+1l$0AEmA݉AރAAD$;A D$4Ec D$L-=!H=- H5+1/HMH0H= H5w+1 H)HfDD$&fDD$fDt$BE) E`D$L-Z^H5r L\$<|$;D$L-+H= L1!t$|$4A@ L-H= 1D$L|EAAAAA >A@ML-|H=l 1D$LmXEQAĨ AAAAL-5"A @|$;D$|$4rA@EAAL-H= 1D$L蠙H=AAAA A@EKAĨ AiD\$EsD$L-H= 1D$LAL-H= 1D$L֘t$AAuL-H= 1D$L藘bAt"L-~H=n 1D$LojAA vL-HH=8 1D$L9H=E1VIbLH5HkL\$4fH`ALGA9 DLxrH5 HHt HAtH=]VHHtH5]HHntH UH=t H5- HD$1qHT$H H=L H51NH=7 H5919H=" H51$H= H51H= H ]HȔHTH= H5H1ؖL-H= 1D$L趖A LH= 1H5荖|$;D|$4L-iH=Y 1D$LZH=M^A@hAAAXA A@EL-H= 1D$LDŽ$!H蹂IHt 8H {LHNL$1H5pLX- $7 H=k L1qAĨD$H=E L1K6A~AAAA A@Ei|$oUE@ |$;^ D$H= H51D$褔AiH=~ H51耔A%H=Z H5\1\跏DID D$M/ vHnwIHF T$1ɾ{HHT$YHT$Ht1ɾ|LYHH= H5R`1ӓL[/L\@8|$wA@-Eg H= H51臓H=QIHt"1HH5"LQ\H=2 1H5,A6pH= H51H= H55oPAHH7L-(ff.fHJH= LH1ĒHAHHuAApH= H51苒1T,H n 1H \D|$D$H- IHL$$@LLHL159\$6fIaIInLpt11LGL$9~(HT$L^HcD$nIH t$LLFL%w M6LLr#MLLLH51QAA L-F AAA uA@EA܀A T$tH= H51ɐH= H5lH= H5lH= H5lH=y H5lH=f H5lH=S H5rlH=@ H5etlH=- H5XalA@|$;D$?@D[A@LEAĨD$L-PA@EuAAAAV |$D$@H=9 L-;1L8D$D$1D$~EArHcT$,L龋LTHqLj>E1HcHAH@l$,Dd$ILt$IƉ\$4Lff.L9LHi0H=c H5l H1]I9uDd$Lt$l$,\$4lH=( H1H5'DŽ$OH= LLH5&HL$LmHF\$LVA܃AAy@EA܃VA@EH=I H51E1HLP\$$f.H= HH5YAL=D-=@R;uLl$H1E1E1HD$mD$fDLl$HM%aLHJBXfLl$HH= L11H5E1E1˂HD$H= *AH<$H;`H|$HH5H~H$H|@LyHX;s`H|$HH5_H?IH>fDC`HD$(f+`HD$ g`DL1E1E1fLl$HE1HD$H|$H DD$3vHL:H<$H:LJHbNH|$XNL5LDD$HD$XdH+%(HhD[]A\A]A^A_1111E1f=E0H=PWD$dLl$H^dH&L;HD$0)HT$0LH'DD$HIHDD$[IHMDD$t?L}LLHHHaHL{H DD$H|$ rDD$DD$HH|$H|$(wDD$0ҁHD$HH111LHT$ DD$0H|$P Ht$ LDD$ >DD$ !HD$PL$…1Ʌ~ILl$MIHHD$H|$DD$ H5ix1H ~9\$PDD$ LMLl$H|$(H|$H51DD$}DD$DH= H5( L|$0}H= H5 }H=l H5 1v}H=R H5 1\}Ht$H|$DD$CMDD$jMH= H5 !}Zf.fAWE1AVE1AUL-)ATLE1USH4HYHWetS|wHcH>wɉ莢uA1E1E1@f.1)`H=Q H11H5)AE1M|E1L"IL&H"CHD[]A\A]A^A_1111E1D+ZI'ZILE11E1`E1ADrLV HHD$wL6 LD$HI5E7H|$e>H$h'H$['H5LM H$jH|$PlL%.H|$HmL.H|$`nL.H$dH+%( $H(D[]A\A]A^A_1111E1E1E1E1ÐH=uE1L%>H1H Hy,@QHDŽ$H] HDŽ$HDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$hDŽ$ DŽ$TDŽ$PDŽ$LDŽ$DŽ$DŽ$HDŽ$DDŽ$@HD$`HD$HHD$PHDŽ$HDŽ$HD$hHDŽ$HDŽ$HDŽ$HD$XHD$HDŽ$HDŽ$HDŽ$HD$HD$(HD$pHDŽ$HDŽ$HDŽ$HD$ HDŽ$8HDŽ$0HDŽ$(HD$0HD$@HD$8ff.[tG<|=wHcH>PH$H$D1UH H= 11H5ArHD$1HD$xHD$pHD$HD$hHD$ HD$XHD$(rfD=;=D~d/H$Otb$PD=O 1HR fD=@.fD1AH=1E1Uf.OH$ NfDH|$PL)H|$HL)H|$`L)NH$ E11H$HHjjH$HPL$Hw/H H$ HD$PH$(HD$HH$0HD$`SN 1HQ$x+NH$^fDH$Jf.DŽ$0DŽ$ MH$fDMH$fDMH$(fDMH$fD{MHD$kMHD$(DŽ$DŽ$DŽ$DŽ$eDDŽ$TPH$BfH$ 2fH$H$ f.H$fH$fHDŽ$H$QH|$0o\LLپ11HǺDHD$0HiL$M&H H$Ht$0LH=2IHH|$L-H$L,QHKLH,[E1KL11HǺHH'H|$@H|$@H,KKH$0~fD3KHD$XifKHD$Q K 1H\N$0F$F$$h1E$JHD$pJH$fDOL$M|mJIHQH$H9HHD$x2L1H$ KLHHH$ Ht$xLH$XR_H$XI#MfH= H5*1kvfDI=HIH@H$HpL++.fDH|$8 gIH|$8H*DDŽ$Hx+IH$HkASfDIH$6fDHHD$ !HHD$hHH$fDHH$fDHH$HHBfD{HH$@HBfD[HH$fDCHH$0vfD+HH$(^fDHH$FfDGH$.fDDŽ$@GH$8fDDŽ$DDŽ$ DŽ$LE H|$ tH|$ H$?H$eHD$(H|$HD$XH|$LHHD11HD$XHD$xHH|$p11LJH$+H|$ht%H|$h11LbH$H$11H$8]lH$8E111H|$XL .uHD$HSH$H$ H$1HD$ H$H|$ r  H|$(t:H= $oH5 H #:1*+HD$pE1HD$hL$L$ D$D$DH|$(&H$HH$H$H H $7H$ (D$EH$wIHH D$EtH$Ht 1H>H$Ht=wH<HHw H=> H$H1HQ3H|$ e H$H$HDŽ$PH$L$H$H$H$`H$H H$E7$lE1H$xH1wS$HDŽ$H$tk$h<11Hc(H$H$`H$1H$pL$D$H$`>HId111H$pII H$`C,4HH HD$XE1E1HDŽ$$XkEupDL?H|$X1HH6)LHHhZu(H$AHtH1H)H$HA0L(A9|H$XM111$X H$Xf1)$)$)$>HHHZH$ H=`IHHL$*BHD$ H$Hx_H$ LHH$HLEEHHEbDH$H7A_H1LE1$L$H$!Y^XHE11$L$LH$!XZD$EVH$uH$H$LHHD11H$cHD$pH H$t(H$11H$L:zH$E111L 1HD$hH@L$L$1HT$hHt$pH$2H= Ll$X11H5L$L$ At_E1LL$ HE111$L$LH$& A^XLd$ H$H$MI|$H$$H$I9D$pu0H$I9$uH$I9D$ uH$I9D$tnH1.H$1IHtHL_L$1H59 H 0!HDŽ$L= WHE1HHNj$1HPjAWLD$HxH H$Ld$ HO1H$HYHD$8HaHD$11AHD$xHD$pHD$HD$hHD$ HD$XHD$(XHD$@H딐]H$HjDs]H$HJDH$ H9H$P$$PL$0L$8H$PH$HH$H HHLl$XL$L$ HD$11ALCH$xH$hHDŽ$hH$H$pHDŽ$pHDŽ$xDŽ$HL$H$L$L$$A\A]HHYH$xHE11ɾ+H$hH\H$pFH$x1HLOHC H=D H5=-1N[HcSH5LH1+[D$ E`1Ll$XL$AH\$L$ 1H=ѵ H5Z,1Z*H$IoHD$(H D$H$(HD$(HZH$K1$$Ht$(H=J `HD$(H"H|$51H$HD$xk H= 111H5\,AZHD$HD$pHD$hHD$ HD$X )H$I1$H|$($Hr7HH[H51 H=0 1HsEHH$C&H$.H=5 H51?Y f.1H81Ll$X1AH|$L$1L$ H=ϳ LH5}*1XH$(HD$(HEHD$HLrH6HHH=0 H50 1HrDHHG%HMH=? H51Ll$XL$L$ 4XH$HD$xHD$HD$(H=ڲ H5t1WHD$11AHD$pHD$HD$hHD$ HD$XCH$hHE11ɾ'H$h1E1L$D$#H1E1 HDŽ$xHDŽ$HHDŽ$H$HH51VH=ر 1H^H= H5(11AVHD$HD$pHD$HD$hHD$ HD$X#LMd'HD$ $HD$ H5c*{E1HDŽ$HDŽ$HH|$(a$H|$(J&H$111H= H5lAUHD$HD$pHD$hHD$X,HD$ HS H=T 1AH5&XU1HT$`HT$HHT$P%H=# H5&/UH= Ll$X11H5 (L$L$ ATE1LT$H=̯ Ll$X11H5'E1L$L$ TAH\$1Ll$(I1Ll$XL$1HD$D$L$ E1Ll$XH$HLL$L$D$L$ D$HL$8$DH$0$@H$(HD$H$PtH$t(H$11H$L9HHH $LH$HtH4Ll$H$HH$LHt$@HLHhH= H5'1ASH= H$*H$HLH$H$@H$vH|$dDŽ$D$Ll$X'H$H$H$xH$pjLeHc$XH5qLH1QRH5Lr.H$pLH5$LS.H$xt.H5gL9.H$xLiH5L.$XuV$`tHcH5*LH1QH5#L-H$hL H5L-$$AH|$A9tH|$D+DLH$+H5)LH11QH$`H$XHVH$PH$L$L$x',_AXMH5L$-$Ge!= W1HD$ H$xH7H$xP HL$ H=L1Ll$X11L$D$L$ L$ H=}L11ALH5C#.,L$D$D AxEpg,H= H51OE1nH= H5g1AO$H$H@>wH=I uH5x"1QOH521A8Of.f.f.f.HvHJf.H(9uHvH/)111AVAUATUSH@dH%(HD$81HHHfHI)$IHD$)D$)D$ IHI|$ tYIL$(IT$H= HH5(1MMl$ H5UL&/H= H51MHAT$H5M1HT$8dH+%(!H@[]A\A]A^1111DH}HtZH$HD$M-H5|1BMCDH= LH5x1 M=H}HtH$HD$DHUHT$:nuRzouLz-uFHLHHT$HUH= HHH51LfH=q H51{L@z 1H=& SH=& V tHH0HHxuH j0PHH5)H=BLH HHH5H HHt4H=*& t*H& fHH0$H{H= uH[1111E1fDH 1111E1ff.fAWAVAUATUSH8dH,%(Hl$(H-ylH'I3Åtct>uH/1HT$(dH+%(H8[]A\A]A^A_1111@H=ѥ LH51J벐K.1k.L=$ Ht$1LL-H=w L1H5HL%wJH=$ uaA9L1IJH=* DIOT$ 1LI0JIH= Ds|$uL1IA98-HHD$ HD$HOHD$FHT$HDcH5$1}IH=^ DH=Q H5Z1[I5fDH=1 DH5$1-IH= H= LH5 I.f.AWAVAUIATL% UHSHhdL4%(Lt$XIL|$"H` H$HLHl$'H3 HLo3H)IHH5LH')LL)H5iLL)HLQHIDHD$IH#1LHH$LLsDHtNH5LRDHLL(1p1H5ff.IHH?I9uIB8HH=vE$ƃAEM&AHkH$A HD$ @HD$HHD$H5"LZ"Ht$L|$nLt$pLL-,LL,L%؜ LL|LHD$ |LLL|LD$0A|LLL~H|$II9}IHlHt$1HuH$HL=^HT$LL=FIHHt$1HHD$(LD$(+L,$LHLD$(L==LD$(HT$LL =LD$(LLH=LD$(~H$1LHHD$8LD$(t[HD$ L,$L9pH\$(LMLd$@Ld$8Lt$HI@L)I9LLLDHH5HH1>I|$Ht$` Ld$`A<$$cD$0ɚ;IH=ɚ;L|$nHt$Lt$pLL-Q)LLA)L%z LL|LHD$[ L|LL|LL$0P1L$HL-|LLTL|LDAcfLH5HHfDHD$(E1E1L-^L3L3H|$(LXLLHL191fH= H551=/HD$ HD$HHD$@IH5HT$ $yHT$ $HHIf.L-HD$(E1E1E1fH=CЉT$0L-VHD$(E1MHt$8ILLH\$(Ld$@LD$(Lt$H8LD$(tLD$(LL,$MILIAHT$ Ht$8H8IuLLD$(ILMIHt$81LLD$(LD$(?Ht$1LLD$(LD$(H$IHtuHl$(LIt]H$HH8uIL-BHl$(@H$HH7tIILD$(LL-IHl$(H$1LLD$(HHD$@LD$(qH<$LD$HL-L}.LD$HHHD$(HHt$ L$L9SH|$@AIH7Ht$@HxM)HHHHJJLHLH)H)DHM9rHt$@DH1Ht$LLD$H/LD$H$Ll$PMIHLHHD$HHT$LH6Hl$HuIHt$@1HLLMLl$PLD$PLD$PaH|$L\-LD$PHI>HNjD$0L$L|$0Ht$@MH\$@HD$X1HH$Ht$(L 65H1HH1H1HHH|$PH$Ht$(L5Ht$81LHD$XHH9Ht$1LH؃HD$PEHT$ Ht$8?H$Ht$8LLD$(=5LD$(H<$B Ll$PIHLE1L$HD$(HT$ Ht$8%H$Ht$(L4MH\$@L|$0HT$LL4ML|$0H\$@L.L.H|$(LLLLH|$L$5j6$$H5 $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@| HHu$$ $ 1ɉ?<>@| HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|!HHu$$ $ 1ɉ?<>@|%HHu$$ $ 1ɉ?<>@|)HHu$$ $ 1ɉ?<>@|-HHu$$ $ 1ɉ?<>@|1HHu$$ $ 1ɉ?<>@|5HHu$$ $ 1ɉ?<>@|9HHu$$ $ 1ɉ?<>@|=HHu$$ $ 1ɉ?<>@|AHHu$$ $ 1ɉ?<>@|EHHu$$ $ 1ɉ?<>@|IHHu$$ $ 1ɉ?<>@|MHHu$$ $ HL$H?<>@|QHHu$HH? HUHHWPV$$H5d $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@| HHu$$ $ 1ɉ?<>@| HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|!HHu$$ $ 1ɉ?<>@|%HHu$HL$H?<>@|)HHuHH,H AWAVAUATUSHH $HH $HXL-Q1E1LE1H!dH%(H$H 1HD$0HD$8 D$HD$D$ D$D$ D$(D$$ff.;tW |wHcH>===~ƉoZauff.AH8IE XXT$$EMD$,&rL蒽HH1MLt$8fDHH  HLl$@HGHt$0HHD$4Ls LPD$$PD$8PDL$0|$,GH uLl$8AIf*SrHT$H5vH= 1-E1A11L%+LLH,LHH$H dH+%(HX D[]A\A]A^A_1111E1E1Eg AI@LE1E1101`fD$D$ nfDVfD>fD&fD D$ HD$0 fED$$A@hfDD$D$( LHu LHAąHT$8Ht$0HHD$4L PD$$PD$8PDL$0|$,H E%DLl$81MLd$8Hl$Ll$MD|$Dd$,Lt$0D|$ fHHHH LLATLn HUAWDL$0|$,IH uHl$Ll$8A1AE1H54gL$(H8HŋD$ H =u;H- L-ۅ #HT$H52Hl$D|$HLl$81AH53fHCUSHdH%(HD$1H$HtCHH^HھH$$HHHH4$H^HHD$dH+%(uH[]111ff.@AVAUATUSH dH %(HL$HLl$Ld$Hl$LLHH|$Llj!H= H5H1(D$t^H=g H5[H=T H5^HD$dH+%(/H []A\A]A^11111E1E1 H|$HHHtHxH= H5H1'HemQbH|$HHH3HLLHH|$.HK11HAH|$zDI_ H=P LH5\H1T'AEtAH@|$H|$HIHHHHt11HH|$sI|$HH= HH5żH1&L|f|$H|$HCHHHx>H}I2H}I&H}IMMLH=" H51*&HATIU1SHfDL;t111HHHuمu1[]A\1111@S[]A\1111@AUATUSHhdH%(H\$XHBwH HHcH>HD$XdH+%(HhHH51[]A\A]1%HFLc(HhE~*IL%\fDULH1H$L9uHD$XdH+%(~HhHH5ͣ1[]A\A]$HFLc(HhE~IL%fDULH1H$L9u@H~`HUHHIHQPLDyH1HH5L2$1H5"H!$HD$XdH+%(Hh[]A\A]11111HFHT$XdH+%(uxHHHhHH5[1]A\A]#HF0Hx H5HHH1#HD$XdH+%(uHhH[H5]A\A]dff.@AWAVAUATIUSHHHOHIHڅ H5%L1E1#DLLL1H5~"HH5dL1"ALWA9DLCHHHIH5L1z"r[LH5LH1W"H_s1HLHH09|TH5L"H[]A\A]A^A_111H5C1!AWAVAAUIATIHUDSHH(LL$dL<%(L|$L|$`HH$-HnHcH>@@vH4$HLH1yH$:H<$HDLAWLL$HAL6ZYH<$9|@H4$HoLjH HHwHHkHHHLH1HHE1E1t$1LL3H߉D$G^_$fHT$dH+%(H([]A\A]A^A_1111E1E1@@HHH4$LHHj=HHH{HL0cHLH߉$J $2fwH4$HLH=Ez H5P1OHH=(z HH=z H5/1#HLHpfD@VuH4$HLDLHHHHHHHtoLH^HJH DH=iy H5R1sHH=Ly H H==y H5G1G2mff.f1fH=y H51 fDH=x H51ofDH=x H51pfDH=x H5V1fDH=x H5]1HHt$1HDH|$joDrBff.fAWAVIAUIATAUHS1HDD$L|$PLL$;HHDLAWLL$HLDD$ ZYtHl9H[]A\A]A^A_1111E1E1fDAWAVIHAUAATIUSH(DD$L|$`LL$nHD$HD$LMEMff.H|$L$9BH|$t$HxHD$DLH蕺IM1<DLfHDLULL$HLDD$ ZYL19|H5L.D$4@HID$xH=;v 1H5oEMc1UH=v H5S1HC HtH@Hx H=u H5:H5<H|$H([]A\A]A^A_1111E1E1H5L1O1fAWAVAUATUSHH $HE1L%8dH%(H$x1H$pHH$HDŽ$HDŽ$ HDŽ$(HDŽ$0HH$p H$HH=H$8IH1HS>H-gD$hHD$@HD$HD$DŽ$DŽ$DŽ$HDŽ$HDŽ$HDŽ$HDŽ$HD$pHDŽ$HDŽ$HDŽ$DŽ$DŽ$DŽ$DŽ$D$D$,DŽ$HD$8D$HD$LD$XD$lHDŽ$HDŽ$HDŽ$HD$0HD$ HD$PHDŽ$HD$xHDŽ$HD$`tG.N|/wHcDH>fD+HD$8~uf.1AHT$@H=r H5a1E1E1E1AH-ݭff.H$0H|$ LaLH|$oHL_H$HJH$ H5H$(H H$xdH+%(bHĈD[]A\A]A^A_1111E1E1E1E1=IcL>@<i@HDŽ$8HD$ HHD$08DŽ$ {1ҾHHD$fDŽ$DŽ$DŽ$+H$fDH$fDH$fDH$vfDH$^fDH$FfDH$.fDHD$`fH|$_H|$HaD;H$fD#H$fD H$fDIHH5HAjL AƅWH=xo LH51f.HD$p!{HD$PkH$fDSHD$xf;IH1H5H@D$hL D$hH=n LH5ήD$AmDs$WD$CD$,3;D$,D$fDD$l ADDŽ$D$LD$XxHD$ HD$0\@H=!7E1E1E1CE1H-@D$H#D$HkH$fD=>UfDŽ$DŽ$ <H|$ H$8aL$l-H|$xtH=l HyH51H$tH=ol HzH51rH$tH=Hl HH51KD$X H|$PtH=l HvpH51H$tH=k H?{H5c1H$tH=k H"{H5<1H$tH=k H{H51$B$$H$tH=Ok HH51RH|$tH=+k HH51.H$tH=k HɧH5v1$|$H |$H^ Dd$hEZAFH|$pH5tH=j H1D\$,H5E|$H5D$D!$tH=@j H^H51CD$EH$11H$ hH$DL$lE#H$H$H$(H$ 迁H$(HD$ HQ |$Lx HD$0D$lHDŽ$XHDŽ$`HDŽ$h ݃GdE1H$ H|$`H$XLg虜HD$81E1ALH$hH$XH$`HH|$8H=h E1E1H- HD$HWfD$[1L9$8HT$0H=4h H5m1> t,H-EHHҰ`L$hEDDED$hL9$8B HL$pHHHEHD$pH$H$H$(H$ H$ HL$LtHl$AH|$`rIH+I+LHH$0Hk H$0LH$0HJ EDD$LE+  $4 E1H-H$蝝IHHAH$@L$8HT$(H$@ZYH=Xf H5A^ H=?f RDH$H$H$(H$ ~jDD$lEiAH=e H5b1HHt$ H|$pHt$ !l$,u=|$ZH=e H1 @H=e H53 H=re Ho1| H=Xe H2H51[ H=7e HH51: =H=e H¡H51 H=d HH51 H=d HoH51 ZH=d HXyH51 *H=d H5ez1 H=xd HsH51{ H=Wd HsH51Z H=6d HsH519 H=d HYH51 H=c 1H5D$XH|$xH$ L ,K LD$H|$xIHW1H|$PH$H|$P1H$`LLbD$X HHhD$L$$H$$H$MIHH$`HL$X4'HD$P:'Ht$PHHL$XHHCHLHD$P\H|$P&H|$PUH|$PH|$PHvLHH>H$XH HAnEH$t.H$H$1H$XLa蔕E14H|$DH$XDAHHHH|$yD9H$MHttHLA"$ttA11ҾXLD$lu8H$8u|$t&H$HtT Dd$LEHD$8Ht1HHD$8@%HH%H at$8LQHSPD$hPjD$\PAVD$L$H$H|$p$H$pH@H H|$pHtH$h|$tM$H$hH$0 H1ɺPDL$(D$Ht$0AYAZH$IHH$0H T$LH$H$E1HD$_H=_ HH5.1#HH)#H5H)lH=b_ H5H51et$LH$D$lHD$0H$HD$ H=_ H51OH=^ H5 15D$XH$XHtk1yHHt\1uH=^ H511E1E1AHD$8tLHD$8E1AhH=V^ H5o1`:H|$Pt+H$H|$P1H$`L]蠑s1E1ASH$1ɾH(H=] H51E1E1AH-#H=] 跪A L$0111H$`诞H$`HH$h11}H$h=t3!I!LH5<HjIH`H6}H$011|$L1E1H-Ht$fH$0L$0H$@H$`H$HH$X辝H$H11H$P蕿H=f\ H5$H=S\ H$PH$P=H$@HtHH= \ H5ޙ1E1H$`HtLcH$X1HtHcH=[ LH5/1H$H$H$8H={[ HH51~H$HdH=4[ H5d1>uH$H$HD$8AH$X虯m1Mu.CDH$XqLHH^uuH$XO9HT$`H=Z H5p1k@HD$`L HD$xH$1ɾH`R11H11HRH$XӚHoH|$Pv|$XHH|$H|$IL@HcTH=Y H5H1B1H|$P|$X\HT$`H=`Y 11H5%E1A_1HD$8FH$0HZӜuHH#xHH$X1҃H-/IH$XHH-޽oHLI˶H$0LXH=X 1H5HD$|$LIDHD$H$HIHHx1H=BX H5H1II$HxI|$AH=X DH5NH1IL$Ht H$h11H$hwH=W H5H1L萻H=W H51%lzH=wW H5i1H=]W H5iH=JW H51T$1ɃPDL$(D$Ht$0;A[[H=W H5 H$H=V H5ReH=V H51BH=V H5@1H-H=V H5\1D$E1H5vM~H=_V rMff.f~XAUHcL-ATIUH,SHHf.LL1HH9uH[]A\A]1111@1111AWE1AVAUE1ATL%g%USHXdH,%(Hl$HHD$8HD$@D$<LHHD$(H15D$HD$D$$D$D$ HD$Aƅ0A A|EFA wJcH>@3HT$8HQuff.fH=T HT$11H5CAE1H|$@1H9LHHD$HdH+%(HXD[]A\A]A^A_1111E1E1DADHH|$@A1E1uS1ҾHğHAƅ1T$8rL萈IHtH|$(HvHD$@H|$8Ht$@}11LLHH=S H5W1HtxT$HÅuHT$H=DO H5TH1Kff.HT$H=O 1H5=!1E1E1E1E1HHL,LH|$PH|$`LHLH|$XH辬H|$`H謬H$dH+%(cHĘ[]A\A]A^A_1111E1E1E1E1D=~1;f=utjff.f1 tMtHt$PLHt$(HL$`HT$XLe9 T$DH|$ rD)IH:t$DXDD$8 E@ 1L1VIMLIHt$HH|$0IHxD$H=7LL$Ht$LHifD$<HD$(I;D$f{HE111҉ƿH|$PzHD$Pk3I[#Ht$xHfH|$x2DHt$pH6~H|$pmDHt$hHNH|$h=DHD$h@HD$pHD$x"D$8[HD$0KHD$ q;1ҾH謖HD$RfHT$HH91@HT$DH t@L1fD$H|$PEHD$Pp%1LHHLd$XMLnLH߉ILD$HL$XL H|$ )vIHHIHt$HH|$0覀IHD$8D$H=]H=wI H5r11l$8cH=WI H5*_1awHT$H=3I H5aH1:H=I H5-r1 1E1E1E1111L1I111L%H1E1E1H=H H5q1|$;H$HVufHT$H=C H521E11E1H=C A̐LDHH!襟H$H LH$FH胡H$GHnH$(dH+%(H8D[]A\A]A^A_1111E1E1E1E1fD$ff.f1A\$ D$!D$8/L$ ȃAD$D$E1 L$ H|$ H$yH$D$u$H=:B H51DYSH5\HI@+H5HHD$H跾f.D$\D$XsD$8cHD$ QD$CD$3D$<ADHD$P fkHD$@[1ҾȞH@;HD$(+HD$0H$H6fLE1E11E1AUDD$ CD$u$H=[@ H51eH|$(tH=9@ H51CHt$(H|$0H$H$X}D$ H5STH5WH8HT$HHH|$`1H5)UH|$ oD$`MH|$ H$H$)$oD$pH$H$HL$I)$DHD$ ~oD$`HD$ HHt$oD$p@H$HP ͡E1ED\$8H$H$EuAPE1E11PHLAYAZT$ uwD$11HLmVHH蹓IHD$fwΉ0uff.f1rLoHHIL1HHIHH|$w6oIHE~MLLIMLLD$zLD$H5K}L15LD$D$gtJ11LLLD$1誟LD$-HT$H=9 H5(1E1E1E11LNL趕L>L&H莫H([]A\A]A^A_1111E1fA.D蛼1ҾH I @{IL1E1E11E1`fDKHD$fDD$E1H=8 H5{1E1H=8 ҅E1E1LLLD$ LD$H=8 1LD$DH5{H=g8 zLD$HD$HT$LHQIH=*8 LD$D5LD$Uf.LT$HHLMLL$=tI@tZ=t3zfD=t1= t 镪DLLD雬MLզDff.AWAVAUATUSHH $HxL-XE1AdH,%(H$hHHDŽ$HDŽ$DŽ$DŽ$HDŽ$HDŽ$>HLH$H-[H苸D$0HD$8HD$HD$D$dHD$xHD$PHD$@HD$XDŽ$$Ƅ$Ƅ$Ƅ$HD$HHD$hHD$HD$pHDŽ$HD$ HD$(@tG|wHcH> E1HD$@$Wu1AvHD$HHGyHT$8H=5 11H5e$HD$0HD$E1E1HD$8HD$@H=I5 AVH|$0LH|$H*1H|$ 詂H|$@H|$8腄H|${H$`HaHHH$bHђcHLH|$跢H|$譢H|$(H$hdH+%(HxD[]A\A]A^A_1111E1E1E1E1=} &HcTH>! HD$01E1E1HD$HHwHD$HD$8HD$@ 1HLD$dL1E1E1pE1H?wHD$0HD$HHD$HD$8HD$@@苶1ҾH~HD$ 2fA%D[HD$pKH$fDH|$ 'H|$HJH=2 H5|f.H|$ߵH|$H軵H$H֡^f苵H$H覡.f[HD$HKHD$X;I+HD$h$@$@Ƅ$$@@$ @$@Ƅ$sƄ$cDŽ$PAED{HD$P1D$0#[HCBHD$(H;HD$x+HD$$ @$AfD=fzH|$PL$0A H|$@$DT$dEHDŽ$<$$@H|$H11H$+H AAZAH$HsHHD$H<$@<$ AD@舄$$DAl DŽ$Ƅ$HD$0D$H|$@HEH  Ht$@H$HϧDŽ$IM%$$= D @k X LH|$XD$LE1H|$XL rLDD$ 11I[HH\ L訞HHD$@蛞Ht$@H辴L~HIsH=D. LH5H1HH0HT$8H=. H5%1&HD$1E1HD$8HD$@\HD$Hf;HD$H HT$8H=- H5]1M H|$X<$H|$X$$HDŽ$@-@AH=- H51Hp"HD$HE*HT$8H=, 11H5{pE1E1HD$0HD$HHD$HD$8HD$@TLHarHA薈E]H|$Hl$H$~oE1Dt$PH\$@EI AD9tDDLLHH'+HT$8H1H\$@H=, H5>!Dt$PH\$@H|$H|$蛀Dt$@E1AD|$P^11H$HxCH$HLH$HA茉E9.H|$D:HHyHuL$`HH/oL1LL` HLH$HHLH=* H5w!@H|$HH$`dA$t$D$E6JHD$0H $DŽ$@$$H32HL$ HHΉDŽ$ILD$ 1LH$L $4VHD$HHAHmH$H܇EEL1ɺLPHHHپHIHD$HIMALD$ 11LL nvVHHD$HA]Dt$@D|$PH|$ht <$ H|$hAE $HD$@-vH|$pw]HD$8H <$jEaE1LT$H|$hH-H5'1džIH$H$L4?&LAƉD$PPE H|$@.$ HT$@H$%…#$tCLcMIt8I1H$LH)H4<HD@>H$DL9u΃$h$@H=' @11H5E10<$HT$8H=_' H51iH|$HH5Q:@$xHT$8H=' H5غ1)HD$0L蓹HT$8H=& 11H5i$`UNDEf$dF H|$P$HT$8H=& H5}1H|$0L蜯$ \HI1jLL$XH$HT$`H|$@]A\SHT$8H=$& H5e1.{Ll$HML3Ht$ $HttL|IHiH$Hփ$== LHD$HHH赽$Ht$HH$HyoI01HT$8H=F% H5_1PH=,% H5AHh+HD$HAH|$@HT$@H=$ H5h1H|$HHT$8H=$ H5ϸHHH1hHD11HD$0HT$8H=$ H5̹1bHT$8H=d$ H5M1n$HD$0@$$HT$XH= $ H5g1*HT$8H=$ H1H5%H$HH=# HH5gHI1jLL$XH$HT$`H|$@輽ZYH|$@{/L$rLXLHD$@Mt"H$:uH$H=NH|$@<$ H|$pAH|$t6HT$8H=" 11H5E1HD$HD$8rH|$pwYHD$8H1E1FL&zL LLHT$8H=c" H5ܷ1mBH|$H=5" 11E1H5?:E1L\$D$E1Ҁ$t <$ GD$dH$HcH$$-wH1E1䀼$2$H|$8H,rH$H5HD$LHHDD$8Hp<$ dH$`H|$HdHIz$sH11E1<$:H= H5e)H= H5d11O1LHL$xHHL 1Ln{Ht$xHD$PH|$H|$w9WHD$HH=' tH5/d^Lay'H5d@H= H5Wd19HT$hH= H5c1H= H5dR1!vH|$0HcL@`Ń"H|$@L賗uH|$0L$1L1E1H5L脥nHcH5cHI<$IHH}H$H|$HdH$H$`HIDx#E1"H|$0HcL_AăH|$@L–uHcT$PH4$E1H|$0ȚAjD$PH5#cH=I 11E1UL$PL纜HމL$P=|L$PE1H$\H= H51E1 HL{At0H|$8H5%H= H5^b1E1H|$8H51E1ݞRH5 L٣AąLcH5aLLD$X?H|$@HI荕LD$X9tpH=5 H5a1?1l$PH5aH|$@HK9H= H5a11L纜HzE1HcT$PH4$LH|$0bAH= H5`1H1zH$H5;aYH|$0LE1HHH=M H51E1TFH$LM1H|$0HHD$P1[H$H5`HT$PLMH|$0HHa[11E1HD$qH= H5`1HcD$PH$LcLH$HA/芐H|$8AH/H=H [hH$LcIH$HD$PH5_LL$XE1H$LL$XHHt$PLHLATL$t$Z^H$H$LcLHD$P1IPjL$t$LL$h_AXLL$X~H$H$Ht>HB<$ H$1H58_LL$X%LL$XI:$-kHbf.f.AWE1AVE1AUE1ATE1UH-@SHH{H(dH%(HD$1HD$sHD$9tU |wHcH>fwljnuff.fE1á螡E蠗HD$HHE1E11DDfDAA~D>ubAwDu@(TH= H1H5`HT$H= H511E1H= AaED1ҾHT`H @×IL1E1E1HH5c`HtrHaLcHD$(dH+%(NH8D[]A\A]A^A_1111E1ADAvD苜dIƃ(H(H5cH&BU҈T$FهT$HHff.VHHDAuM`Gg KWHL$Ht$dHt$L$H3I.Ht$ HL$褐,HT$ HL$HT$tYHHH9HHT$H=t8H= H51۷fD1yHD$LDw;GIHAH5K^AH|$HtbfDHL$HH9HFHD$IƉD$虜PAtXT$HLD9/HL$H)L$uA11Ҿ LZVfE1ID9t$~BT51H5ֳL覶tHHD$1<茀HHHLH譃H5&]IH|$H>DH= H521蝆H54Lf.f.DDH5\nff.H6H?AW7L= AVAUAATIHUHպHSH(HDD$DL$ Љ)M4Mu+jff.ff.@M6MDAF9uE9nuM~MtdMCIwH7uCD$ fA;GsfAGD$1H[]A\A]A^A_1111E1E1M?MufA~H5[XH[SHHfoqIfoq@foq@ foq@0foq@@HqfAWIGPIGHIFHtL8I~hM~AAGHc ILfAFufH$Lc- Ht6L<$IIwLL=`t9IwH轔ItHuL<$MqfA~ADHH}HDg}H= IH5HH1=?}H= HH5H1f.H5#Z H$fo3pH$Ifo1p@IfA^IEnM4M~HL{kH=\ H5Z1fmAWAVAUATUSHH $H(E1dL,%(L$IH7ILeHff.fAHHDPƂAIAM9uր}.H} H5NE1dpHXAH<]Ht$ HH|XHHD$8urH\$LHMH=wUDE11HDDDH$dH+%(u-H([]A\A]A^A_1111E1E1fD褁@AWAVAUATUSHXt$0H|$ dH%(H$H1HD$hH\$ H\H5/D$LHt$(] H=Ld$hnHD$XHuLYH\H5WHI!IHH|$XHxoL9IBHt$ LHHuLUH\$XHD$LH5WD(D$8HHHD$HH$a_ADžHD$pD$1HD$@D|$Pt$H|$X/L<$Ht$H6WLD$(HL$ IHL1t$89}~Ht$@L@xm$%=*.HIHt/IE1HVLJ<趂Aą IIuE1H5_L菤D$D$9D$P/\$@H- LmML$LMII޹ 1LAVHT$HcIMfM6DD$Lff.@HfD9sHʉH0H3A|HHuH\$01L|$8^fA|$5^I|$H5UfH5 ULfMEFMAD$M<$fD9sAVDHTANHt$H<$LHTU1Dm EvIT$H $H5U1H=C NSff.ff.ff.ff.ff.fALADu߈D$AFH5SHTD\$ENU4LD$81HL$0Ht$H|$PD  _AXDT$ED\$rH<$D\$DT$YDT$D\$I|$H4$D\$DT$FDT$D\$E D@;t |/ D$LH?nHD$(HT$ H= H5sS1afDENPH5RHSAF4HL$01LD$8Ht$H|$J  XZH<$XE84SHuH $IH=F HH5/S1MD$@MH\$0L|$8H5cRL"dHyLHEH HH99H|$XH5虠H<$H5RcH$HdH+%(D$@HX[]A\A]A^A_1111E1E1E1E1DDT$D\$8 D\$PDT$&RHD$tLD$H $H5'RH=- H1;D$@D\$PDT$fDH$HcL$LH5QIT$H= H1D\$DT$Xf.H$HcT$LH5QH= H1迩 f.D\$TDT$PC8ZQIL$HD$HL$sLD$HL$H5iQH=V H1dD$@D\$TDT$PH5PL;bL#OH= H5PPH$D$@H4$HH<$H5EbIH111LQLIuMLLXL19H8HHD$L$KvHT$H5o 1IH:L迁D$MXD$06LD|$LHAAqDHT$ H= H5OHT$ H= H5>O1ЧD$@qH= HH5H1裧HxHtRHD$L$pHT$H5w 1IHzL&_D$H=7 H5NCMfqH= HHH51"D$@>w+I3HL$dLLHD\$dHEt1|$ALHAAă|$0tDpH=~ H5AH1ff.fAVAAUATUH-HcSHdL,%(Ll$L-LI讎Å|wHcDH>w‰uf.1HD$dH+%(H[]A\A]A^111D !Ås HtHHt Oq ?wH}H@HDDH}HuV@L؉3H=LH51E1A`HhzHHtqL-K:5LfD$股IHt|Hl$HHJHHtfDx1H,HHu=LLT]qZHHD$dH+%(uHD[]A\A]A^#tH=H5K6#f.f.f.f.f.H5K\ff.}AWIAVIAUIATUHHSHLD$OLI~OHIDI9rALLHsdJ|%HSLbdH[]A\A]A^A_1111E1HT$H=L1H5+KӢH1[]A\A]A^A_1111E1AWDAVIAUEATAUHSLH5 HH|$AljD$ ff.fH=A11Ҿ ;FH LD$PHHH $!H=HH5 71< <.CH#NHcHT: bIA97D9~ |$H[]A\A]A^A_1111E1E1DH=iDH5ך1pz ufEuaH=BHT$L1H5ID B uKHdHGHff.1H[]A\A]A^A_1111E1E1Ð fA>t4LD$XLHH F@{ @H=qDH51xH=QH51[1V@AWAVAUL-ATU1SHH)dL4%(L$IDŽ$xHDŽ$HDŽ$HD$PDŽ$|DŽ$DŽ$HDŽ$HDŽ$VH=H$iLL>|D$H]HDŽ$IDŽ$DŽ$DŽ$DŽ$DŽ$ DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$DŽ$DŽ$HDŽ$HDŽ$HD$8HDŽ$HDŽ$HD$xHD$`HDŽ$HDŽ$HD$HHDŽ$HDŽ$HDŽ$HD$XHD$HD$0HD$(HD$ HD$hHD$pHD$@{tG3.|4wHcH>DŽ$D$8u@1Y H=LH5^1艝HD$`D$HD$PHDŽ$HD$xHD$HD$811E1HD$HE1H=)EH=B mzH=. azH|$XiLoGLSHoH|$ eH|$(eH|$0eH\$H5%HYHIH|$h+EH|$`%H5DUH|$wH|$P虝H9H|$8/H|$HUSH|$@SH|$pDH$HD$xH9t.H5xD.UH$H$H9t0H5RDUH$dH+%(D$H[]A\A]A^A_1111E1E1E1E1=~Y fDyH$~fDDŽ$h=U>FDŽ$0D$DŽ$+yHl3~H$fDxH|$H$ iH$HIDB  fDGHDB u=H$CH$HH)H5BH$2HH H$HH9sI4$ HH9 PDV uH9 H|$HH$gSH$HI H=HH5B1˙H5BLR)fwHwH$|Hc~fwH2H$HRmwH=.H5BH15L11E1}E1D$HD$`HD$PHDŽ$HD$xHD$HD$8HD$Hv1ҾHT?HD$pf.vH$Hb~fv1ҾH>HD$hHNIH=,H5@8KvH$xH.vH=H5xH1hH|$@F u1HxHD$@H!fHDŽ$D$DŽ$DŽ$uH$nfDuH$HKfD[uHS+fD;u 1Hx$H=LH51VtH$fDtH$fDtHD$HftDŽ$H$sDŽ$DŽ$UDDŽ$@DŽ$0DŽ$ DŽ$ H|$0tH|$0H2U4DH|$(sH|$(HUDH|$ sH|$ HTzDsD$HD$8YfksHD$xA[sHD$`1KsH$fD3sH$fDsH$fDsH$H_ rHD$PDŽ$DŽ$諾$1H$ D$Ht$xH|$`H$H$3k$H|$P(HAHHH|$X^H|$X1HH\HD$PH9H=t +:H=H~H$HH]jH$mH$11E11AHgH5pH(VH$1HH=TIH=7tNH$11E11AHH5HUH=1HH<GI H$HD$x H$HDŽ$o H5H=H;bHHtHrH$t>H=uH5H"HDŽ$HHtH5bsu HDŽ$HLD$p$1HH$L IH H59H=H|$8tH=H51訑H$HD$` H$ $H$H vs1HD$PH'MDT$MEZ H$tH=H51H|$He(H$E1H$MLL$HL$HL ՊH9$HLELD$pH|$H11H$HD$HIH2(H$H$LL:1HD$8H LHjKH=KH5=$ D$'H$H$t%$'Ht$PH|$q 1a@H|$H$sH$u2H$H|$X1H5$Ǐ1f.H57HHH=}H$H51H=[H5̉1HL$`H|$H57JH蠊HD$(HnD胊HD$0H!okHD$ HiWH59H=b7LH HHH5iXI!SHIHD$XM H Ld$$tH=_H5 1iH$tH=?H5H1IH$tH=H5x1)$xH$T$j胁H=H51֍oH=H5轍/H$HD$PH9H=1kIHt+H5*HFHHXH`mH8ZH=qH=-1H5Ԉ7H$H=H5E1$Hi5H5\H= HHEH$HTH5&H=H!H$H=H5*51艌$H+6H$H5H=HHa/HE1LD$*"H5H=MxH5H=:H$H5Fu HDŽ$H|$8H|$8D$P0<  1E1DmIHHD$8H|$81H53HD$`H|$`MxL$MHt$`L+r Ht$hH Lq1舂Lp9E1L\$`E1E11E1LL$PE1LL$LL$8LT$H|H脡Ht$`HHUHRH5H=111E1D$H=H51ME1H$M 1H|$8H|$HH$M HD$8Ld$H$HD$PHD$8$$L|$AE11H$1LHhuH5qH)DH$HtH=ULHHg>H=0HtHL$H +H?>HL$(H$LH|$H$tH$HD$8D$H$1HD$8D$EtAMMoHT$0H|$LCH=SH5D1U$$t#$$ ȋ$ L$H$$HtH$HtH6aatwH$yIH$$$H$$FHHLHe.D$$tH7MHH5)L$$H1KHHH5)LF[H5HeuH50(HeaE1H$H5HHL$)H$Lb;H$\H5LZ$ $$Ht$Lto$ t^t;E11DD$%H=/H5(kZ1H|$:kHH=H5T1 ~#&뙋$$tHt$HLTdH=H511}pH=H5/(1}.H5Y(LY"Ht$HLHD$t'$H|$JtgH=H5:1}$D$$t+D$}H|$iHHt HLp $D$qH=H5*'1|$D$`H=v11E1H50{|$D$61E18H=BH5kN|H$11E1D$HD$8D$1E1H|$!iIH{$1ۉD$H=H51{\H|$hH$IHIH|$PIoHT$HH$Ht#tH=nH5~1HT$s{HT$MLt$HHT$H茚H蔚HHHH HD$@HHHTaLH)$H$tH=H5J~1z$AHH$H${Ht$8H!]fM]LH/J$xH$tH=CH5}1Mz`H$E11HH$AH/nH58HH$Ld$L fHD$HH$H=`H5Qqll$VMHD$PE1Ld$H$HD$8LD$HH5HuH5FH H$H=@1H55jkL%LHH5HupL%J@HLuZH$3H=lH5GHXL%]HLYt>L$I6jH$H=1H5)ikH5DHuH=H5hGHdXgH=H5hFOHHLHHZH=H5&hjLy! H5aH=H JHH=='H51i1BjE1E1M1LT$1E1LT$8L\$HD$H$thHD$`E1H$j1H$E1HL$PbL4HD$8H1L H=H5EH5`H=HsdH$HD$`HH$E1LMH=/1H59iH$E1L\$PH5fn11 iH\$Hp61H5[HHt$PHJH|$1>6H581HMLd$H$H$1H$MHt$L nbHD$HE1D$11LL$8E1#1E1HD$PfAWAVE1AUE1ATL%USH=XEHdH,%(H$HHDŽ$HDŽ$HDŽ$DŽ$DŽ$DŽ$1HLZDD$1H-%HD$D$LD$4D$HD$0HD$ HD$(HD$HD$8HD$@O3|PwHcTH>f+EH$HF1ufHT$H=11H5AE1f1HRHHH2LHH$gH$HH$HkH$dH+%( HD[]A\A]A^A_1111E1E1Ð=D=FDDNf.1AIH|$H$:EDL$0EHt$ H|$(H$H$H=wH5J1e1A1E1 $f=@.@D$[HHD$ADCHD$( CHD$ D$HD$LD$0sD$4cBHD$8QBHD$@AB1ҾH H$@{BH$H.IfLE11E1H1PfD$AHt$ H|$(E1H$D$4H$ D$A)EtDD$HE9$EA7H$H|$@IغL D$HHH5PHJuH5x HI"$H|$8DIH|$0t"11Ҁ|$HH4dt$LL$HT$41ɅH=H561HL$b$Z=K  HL$|$D$L5_1E1LH%HHD$THL$ALH$H(HL$=FH|$1H\HL$H$HL$PH|$1HL$HL$MtL H|$LHHL$$ fH|$PH$HL$H5)$)$)$)$)$>oD$PHD$pH$H|$)$oD$`H$)$HL$eHLHL$E1HL$H=ûH54A`H=HL$$AH|$@IغH$L 3D$H H=TH5uk1^` = E11H(HHHD$ BKH|$ D$MD$]H=ʺ1AH$HH5,HDŽ$ LH5o 1_H$L<LH5{1{_H$=H=J]3a`fDD t$L5U|$H a HHEH=H5X ^1AE1&$ HHL$D$ HL$HHt%AA~A AFL1HL$AH=fH5r^HL$H=IH5 U^H=6IrD t$L5EH g Hf HDE1LHZ!HHD$OHL$VD t$L5r|E11L5H=H5n 1HL$A]HL$H5 L1]H=eHD$1H5hj]H=K^D|$HHL$HLHL$HL$a|$LHL$t7QHL$Ѓ|$LHL$t((HL$J9HL$3HL$H=H51 1\H=~H5A\HL$-DAWE1AVE1AUAATL%ULH-SHhdH%(HD$X1D$DHD$HHD$P8D$0HD$D$4D$8$HD$HD$(HD$ HD$;DtW"|wHcDH>f.=}wctXCufD1D$<?ht-ADT$<EH= H5I1[Ao==.@9HT$DH!% fHT$H=H5{1ZAE1E1E11E1E1LD$HGHdH|$LB'L HLJ!HL:H|$H"H(D$HD$XdH+%(3HhD[]A\A]A^A_1111E1E1E1D8HD$fADAD$A7I71ҾHHD$fL(>E1{7HD$(k7HD$ $wD$0c$W$AA6fD&fDfDfDD$8D$411HT$HLDT$}DT$DT$AeALD$HL$H1L t$DH|$vDT$HDT$HH|$ rIHGH|$(wIHHKH5' AHcL$ 蟔IcH5HHT$I腔HT$LLIHT$PT$ *DT$kt$0HHD$t3HT$HHt&LITL:0HH@x@rH9u11HDT$9DT$HI$DT$LL $<h<V<kFL $DT$LL $DT$*L $aLD$LHT$PLLL $DT$8L$4HT$PID$8LLL $L $E1fA1H|$11L{[[DT$HItHDT$aFLHVDT$LD$t$D11H|$L zDT$HH=°H5\UE1E1E1E1A#mDL $~! HDJ t,AmHwHDP uZI$HHT$dH+%(uBH[]A\A]A^A_1111ff.ff.@SHDP tf.AWAVAUATUSH8H|$HHt$dH%(HD$(1D$1E1L58CH\$ AH|$D%I6HD$ HHOL-CfDIuIHtsHAUHIMH\I1H=H5XJAD9d$u1EHT$(dH+%(H8[]A\A]A^A_1111E1E1I 5LH|$7H=xH5D$+D$txAAdH=HH1H=٤H5:XI,H=H]H1H=H52XIE1;1<ff.AWAVAUATUSH(L?H|$LHt$H5%HH'HA?I@@|$DM|$1I1AI@t8I6@DF uxY uIA$1IA?1@uɐLL)u^HL$HT$L9L*H([]A\A]A^A_1111kH5 L1H([]A\A]A^A_1111wH5LT11HAVAUATUSH7H dL%(LD$ILt$Ld$HHl$H|$LLHj V<$LLD$HH+D$I96LHLH04<$*HD$HHT$H)H9HILHI)LHHD$ |$@<$ILL+D$HLH<$ HL$HHT$H)H9H4 H~&ff.f. H H9uHT$dH+%(uyH []A\A]A^1111E1H=H51FH=|H5Z1FH=eH5]1oFH=NH5j1XFUHSHnH gHcH>fH?1F$^H=H5m1EH=ڠH[]1111fH=H51EfH=1H5EH}tH5HHT$tH|$H51_H=(H512EH}2DH=H5I1EH}wH}H}X=H[]1111H=H5jS1DH=H5S1DH=H5S1DH=rH5S1|DH=]H51gDH=HH5S1RDH=31H5S=DH}tPH=H5S1DH=H51DH[]1111ffDH}H==t)H5T1CfE,H5S1CH=sH5S1}CH=^H5S1hCH=IH5 T1SC3ff.AWAVAUATUHSHHHhdL$%(Ld$XA3HD$E>HHZH[H5XH1BHIHLI$LH5HH1L-BHH5HH1zBHD$PHD$HH%fH=HIb#H"IMt L2HH5H1'BHMt L2HH5H1AH11ҾIHH~H=œH5w1AH$11ҾLHH~H=H5S1A=Ld$LtLHt$LHkťH1H5+dAT$LHt$PHSH5@H?Ht$LHt$LH5H1AT$LHt$PHH5HH7HtHH5SH1@|$HV HHHC H H=H5H1{@HH51Hc@Y8H1H5L@Hc=A8H5 }L5ILgjLE1jHc8ILH4ZY.H5H11?7L5/:~(f.A,1LHH?9-7H5H1?;H5L1LH?HD$XdH+%(HhH11[ ]A\A]A^A_=DH5(H17?EfH5H@uH5H>H~HIsLH5HH1>HIHHD$H5+H1E1>HD$PLt$(Lt$HD$Hl$0 ALD9 DLDH5HH19>vHI L1HHyH5 H:H5H1=vHIiL1HH9H5˼HH IHtHIHLH HL$=Hh6LHD$ LD$ LH߉H5N1P=E1Ht$H L;H5H1*=H/HH7;H5H1=Hn+HH;H5HD eEdHHT@L-H1LH$H$L$HMH$$uLH H$HH5H$}La H$~LH$IA HD$xMHH$H$H$1AH9$tLHL9$tLLERH|$XHt1H$H$: $u$2H$HSHH=͆~HHH$11H$GH$11H$&H$tH$hH$`LD$hH$L 81ҋ$tH$` IH(H|$H$Xt.H$H$X1H$LcLH|$tN$H|$H 1HHlLHD$HuLH|$H`LH$G5LH=ZKH$H$(11HH$XݓK@I@H$LHHD$HHH|$1ɺNq$*HHT$Ht$PH|$ /> H$xHtH|$H H$|G$G$\G$X>G$F$<H$,`H$0 H$4G$~ H|$Hc_$8tDH|$Dr iHAR$Pt$ $L$(L$H$H$H$8H|$(>H aHH$Pt6IHHH$PHHH|$LvH$Ht"H|$H"HH$WH=osH=NLHH|$H5+H$ HH$H5IHWH111HLHĂ?H=HH|$H5H$0HtH|$HGH$Ht H|$1H=?tH|$H1H5 赻H$pHtEH$0 zIHG$0H|$HGLLE1HA6ID9$5Bt`WE11jH|$L H1҉$ZAXAY$uH=xH*DŽ$DDŽ$@D$1퉼$DŽ$DŽ$DŽ$;~DŽ$nDŽ$^DŽ$NHHD$h-xH5"HiHD$`H V1E1AH= wH1H5g1HD$xH$HD$HD$HD$yDŽ$KDŽ$H$DŽ$DŽ$}DŽ$DŽ$DŽ$DŽ$DŽ$ADŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$H$x{DŽ$DŽ$DŽ$DŽ$DŽ$?$DŽ$(9M$$DŽ$89M$:1 HH=tH5-$,1$9M$$H$(9M$v$H$9M$LH$:H}D H$ETH$H0HBDf DaHEu+HDŽ$ HH$h$E1䋜$1D$`A͉$dH$hID9 E9t B|%,AT$uH 1H|HHcÃfD`d AD$fH$ TH$DŽ$2H$ H$H$DŽ$H$H$}H$kDŽ$[H$IH$p7H$%p 1H$,P 1H=  =< = Ƅ$8 1HWH@{H$0yDŽ$<iDŽ$YH$Gz8DŽ$(DŽ$cHzRHD$CHD$DŽ$H$DŽ$DŽ$DŽ$DŽ$;DŽ$H$DŽ$DŽ$DŽ$DŽ$WDŽ$H$DŽ$DŽ$DŽ$DŽ$DŽ$(IH$`7H$X%H$H$tH. 1HDŽ$.DŽ$u^DŽ$^^DŽ$H$H7f.H$pH~fH$^H$|H5Hr:DH=Y1E1D$1DŽ$ DŽ$DŽ$n HD$PH;g  X 1HHcH>DŽ$XDŽ$TpsaDŽ$PQDŽ$ AH|$@H|$@HfD[H$HDŽ$ 9H$DŽ$ H$H$hH$D$xDŽ$$yD$xlDŽ$\\@D@H,H$#f1MU4f.H5o;$D$`$$d/Ht$p,$#u9hDŽ$KHD$81;=u|Ƅ$8'HD$@H$D$`$$dHqH=gH5~1 Ƅ$8HqqH=gH5 1 Ƅ$8H=gH5,# HD$AE1HD$HD$HqH=XgH5 1b HpH=7gH5!1A eHqpHD$x1HDŽ$%H=fH5 !1 H1^HupH=fH5W!1 HTpH5 HApH=fH5! H"pH=sfH5D!1} H=YfH5!1c H=?fH5K E1H|$tLD$hH$1L !$tH|$@IHj6H$$pLH|$HD$HtCHD$HToH=eH51 H=eH5  1AHL$HL$H=\eH5!1f HnH=;eH51E $1$ 0H|$1/0H$HH|$B0H\$$HH[AV$HPL$D$H$$H$AZY/H\$$Ht$H/(Ht$LHD$H$$y/H$t/Dm$$8H$XH|$@H$tH|$.H\$1ɺ,HH5HH$HH*RHH$H9$P|.$T-=ld-H$HtZH5awIH.111HLHH.H$H.H$$tH$1ɺ!6$E,H$,H$r+H$H$u(+H|$@*Ht$@H$_*$ :*$$*$$ȃ!A)H$pu+$tH=kH5˺1H$x1DŽ$H$pH$H$x$$P$H$$X$DŽ$, D$$`L$Ll$(D$L$H$袦E1L$AS$$hP$Pj$PD$L$H$H$H$H$*H0)$xH=]j1H5$`&$&$x1ݿHH6&|H$H &L$$x1L2%H$1Ҿ HCH$膥E1Ƀ$L$%H$@11H$yL[H9$L1ɾxLH$@.H#$#=Li$t8'H5L'HD$`HH'1ҾLǮ$@$DSHHLLkL9k$0E1H$L$L$tA5hHE15^L$H$xH$H$^_ $|F -H RHcH>L$0fHHHeHHE1@LH~ A}"a11Ҿ HHHEuH=]H5r1H5aH1@LH$zHc$HADcH\$0LH脳HܜH5WHaH$t>L HtLHhH=fHt OHD$H1L$0H$H$81H$P$HDŽ$@$X1DŽ$8$\$$4$H$L$AH$1 H$ 󫋄$ $1H$ LaAƅ$Atr$tH=\H5YLa$,H=eL˽$|$(WE1D$D$,D$EwE$Pt+hAhHcDH¸HH `$t+hAgHcDH¸HH D$XhLLAHcsDH¸HH `u$t?$8LYLANHc&DH¸HH L$ $01H$H$E1H$ tL$E$H$u$8H$L$LHD$HDH$8H4LƉ$ q H=Ƌ$ H$8Hc4H>L>HcLL&In7fHcL"fHLHc$4HD$0$HCf~Q)$$$4~%1$8H=bH5411!E1AD$H$L$H50H=hbH$H$H$D$HD$(1$t$,H$H=b_H$E1H\0HH$foح)$Ht$0H$@w~TH$D Hc$xt$xH$IH¸HyH `11CH$R$tH$H=9awH$蚯.L HcLL`HL$ cHcL`cI$H|$H@c1҅ $P$?1H$HH$H9$11H$PMu51۽nH=%`11H5LАEH$L$H5H=_H$H$H$D$HD$(1Axu Moz$t jH$L$H50H=UH$H$H$HD$(1AH$L$H5H=UH$H$H$D$HD$(1vH|$H b11H9~JHt$H< uH$L$H$D$H$H$HD$(FPH|$HHcHD4HcD7A u߃4Hc7 H=;^H5կ1jHcHI)H$L$MŻ4H$L$AH$H$H$HD$(蒓H=#TH51+b`HciL`I~H$L$H$HD$(H$qAH$L$H=SH$H$H$HD$(荠H5ZH=\11l!rHIHGHH@LLH5"L1"11Ҿ LLL@aH5LHI11Ҿ LțLLH=RH5"1H5H1@LH$* Hc$H5}LADvHHT$(H=9RH5WL$H$H$-UH5\H11Ҿ HH\$0@HHu&;S`L$H$H$L$AH$H$1HʪH$LIA}.t<@LLH$L$eH Ń$11Ҿ LLI܉LLZ@Ht$0@H&…YH\$0C DK9HD$0x  H9HL$0<uH9gHL$0P H<HL$0HcDH$H5I11Ҿ H(>HHHHHL$WH5eH111Ҿ H՘LM$01H$1$ L!L牄$Hc$Hfo tH1H `1)$RHu11Ҿ H<@LH$1LH5La$== =6=H=NH5*1L$H$H$11Ҿ H}AH$$011L$赻H=>NH51C11Ҿ H"HH$H=MH51L$H$H$ H5 LHH=MLH5A1gH=MH5B1H=vM艚AH=eMH5.1L$H$H$WH=3MH5!1L$H$H$%MH=MH51L$H$H$H=LH51L$H$H$H=LH51L$H$H$H=kLH5@1L$H$H$]H=9LH51L$H$H$+SH$HHuH$HLuHJH5 H1@LH yHH L5 AD0LL迒Hu0@LHHADHL菒HtH5 H1iHt$0@HH|$0HH5HHOAE@LHEIH5}L訜H5^HܿHIHHſ11ɾ H褓@LHHL;艵HHHHH誼@LH誾$~3IAUHDPtAUDPtAUDPtA} u 11HHHʻH5SH1Ht$0@HBʹHUHHHHE1@LHH5آH1z11Ҿ HYHH$A}.t=@LH衽H$L$:HA ƃ$11Ҿ HHHӺEuH=HH5H 1H55H=HH51L$H$H$@LHH5H1zHt$0@H$H=:HH51L$H$4^HDŽ$莱H1H$IHMHH$H5PL$H$LH JH$苹HH6H5HHOHIH HIFHHp[11ɾ H:LB@LHbHcLߣ$r$H=F1H5 L$H$H$ܱHdHHHHA}-u@LHH$uHH$$| H$zH5H1N11Ҿ H-HiE1H$A}-u=@LHrH$L$ HA ƃ$11Ҿ HĎH|H褷EuH=EH51H5H=EH5p1L$H$H$qHL$H$H=5EH51?iHL$H$rH=EH5j1 71LADH\$?HH1Ҿ@HH BN蕯eH5IHH5"NH"H&L8虍1Ҿ9LH MÓH$L$H$1HH$H="DH~=H5q1'QH$L$H$HM'H51H5H111Ҿ LH_LNDŽ$L$H$LL$L$ HT$(H=2C1H5NL$H$H$$LHT$(H=B1H5L$H$H$H$H5ބH$HEH$L$H$H$Ht$H@H$輹H$Ht$HLL1LЀH=3BH51L$H$H$%H$H=A 4H=AH51L$H$ L H5L1A A}"Mh FH$cGH=_AH51L$H$H$QyLEtH$H$H$L$HH$0AH$HH$@HHH$HHH$貰H$@H$HH$H$L$HH$H$L$tUH=S@1E1H5̔L$H$H$ByH$ sEL$D$H$H$=H$f1)$ H$HDH$L$HH$H= IH51$(L$sL;L#Lt1$$,$H$H=?$$(uE1D$|H$L$H1H$L蓤$Ht$0L@~LA } MH HcH>LHcLH`H$ H$ HLHcLHH$ HH$ H==H51~L褜LDLA9HcDH¸HH `H=GH5ژ1ALwE1D$A ,1AH$L$H5H=FH$H$H$D$HD$(1MH$L$H$H$H$HD$(/|$H=<D0H5:H='FH51VH= FH51AE1D$A *Ee$4AD$DŽ$H5DH51#ZiHHHtKHQH2H=;HH5L$H$H$H裭H=;HH51L$H$H$HfD$H$11HyL$H$H$蘊H=);H5RH10HP'HH=62\H?H=6H51;H$H5|{H=5H5%H$H5Cj5H=5H5HL_L9@-@.AT.A|--1AvD^A9wMsH1[ȃ!D`|H蒗rH>H5H=41H=4ՁpH\$H45H(HH$1Ҿ6HH$aCH=m4H5*yH=Z4mH$H5H$HH|$Dյ:H5yH|$_Ht$pH|$H=3H5H=3H|$ 鮸Hc$H|$1ɾ{肞HbDH|$eHc$H|$1ɾ|GH5 $H|$H$xH=,3H558H=3A&骯$4H|$1ɾ~ٝH)$4H<H5H=2z$0H|$1ɾ}蒝HԷ$0H;<H5H=23$,H|$1ɾ4KH$,H;H5uH=>2QH|$1ɺ!0H;H= 2DH5H5LH5#H=11H=1H5H=1~bH=1H5߲H=1~H$1H=);2H=:5H=:H51[隷H$H5@H$H56H$H5"H=0H51H=0H5G1}H=0H5X&AE1L\$@= :t =3:tD=H :H:HD$HnH=`0H5hAf H$H9tH|$`uq=HD$`HuH=0H51A H\$鋬1AHT$y1AHD$HD$btH=/H5E1AH=/|HLLd$#1HD$HD$HD$$f.f.f.f.f.fHHHA11111AT11UHSHHՙHH5H111H߾谙HH5H111H߾苙HH5H111H߾fHH5$H111H߾AHH5'H1]11H߾HH5*H181H1ҾHH55H11H1ҾҘHH5 H11H1Ҿ識HH5H11H1Ҿ舘HH5 H11H1ҾcHH5H1H11Ҿ+>H11ҾI*[LHH]H51A\?ff.@AWMAVEAUIATAUHSHHT$5HAtHcD$PH[]A\A]A^A_1111E1E1f.Htŋ 6tH56H~t$XD$XMELDHPHT$ HHD$`}XZ{AUATUSHH $HH $H(dH%(H$ H=L6\H贰H=U6HHHHt3H=66H51H=!6H!H=6HRH芄H~55Hl$ HH]HtH=5HH5,1`HXH0H=5HHnH=5HH=p51HH=_5HHHH=F5HDH5ː1HHT$Ht$HǟH|$t?H=5H51Ht$H=4T$襟H=4H5N1HxHtHH=4H51kHr3H=4H H脂@H=Q4H=l4H51H/4H=P41H5~H=541H5tHc=H5w H-3IHzjHHjHcyIE1LZH=3Y*H5?11zDL-~+fA,H=31LHF9-H=3H5)M1)F H5?LH-11ҾIHqH~H=(H5~1H:11ҾLHqH~H=(H51H=211Ҿ qH$ dH+%(H( []A\A]11111E1E1DH5 1R$DH=2H5A13fDH=i2H51fDH|HHbH=52H511ɺHH=2q2@HH=11H5PHzH=1H51u ff.AWH5AVAUATUSHR1|$@dL<%(L$IωD$I H証H H蘼I`H舼HHMH21@uH#HH=0IHrD0EMtLwLL許 |$1EIH D0Et$xHHH L\ILLL苖L|LLmnLH#D 0E3/t9H5L1H /LHHD /1tDa/ELl$(L@LLHADž;1LcH=%H5n1 H=%rE1퐺/H5&LLԖH\tHTtH$dH+%(u H[]A\A]A^A_1111E1E1E1E1f|$貓:D5.EH=[$H51eH8H\m1Ҿ9LH .sL| HD$(HAf.L=eL-@f11ɾHlH@LHE-l H5Lu@H5Lu{AD$M|$tWL< <:r<.tuH5mHI贡AuٺH5HIdD9-*wH5IDHE1uLHH5H1)LaHHD$tD$~eff.H|$DA菟HHD$“H|$IELH5HH1D$AA9H5CHȠ@LLhIHH5H1E1hAED$u,fLHAAD$H=2fLejLcH5K<,It\Ol/H5L1tDH5uLt1H5CHH=LH501讽H5:HʙuAHH5謙HLLH5,1eH]e=|"H='LH51.LH5rH=H51@AWH5A@AVIAUATUSHI߂HgHߏHWHHH@uH HH=!IH5!MtLhLL蒢z1D0HHdHL詇LmLHm_HHA '!!tk0H59LQH LHHD 1e0fDH苠Hv11ҾeHM_~H=:H5 q1L5q=Lu@LH腊ŅHH=G L1HtHG詬LmH=bH5{LsHpHdH[]A\A]A^A_1111@H8Hd^1Ҿ9LH df-HID t HuLc1LLrC< ULH11Ҿ H]H躞uL~1H=H5|轕H=naH耗H=H5r|1RH5H=f.VH5V|LufH=H5%|1-L8H5aH虴H- LHH/ef.H5QL!H=H5y1wH5H=)*H=21C`ff.AW1AVAUATIUSHH|$/`HI|$IHH5D{1ImA]tLL5"{DLxІHH5#HDX@IDI|$D1H薷]uI|$H5k1{I4$Ht[Lu~H=t$I|$H5z1IH5H|$}H1[]A\A]A^A_111ÐI4$HuH[]A\A]A^A_111DI<$uAD$H[]A\A]A^A_111ff.AWAVAUATIUHSHHL5vdL,%(Ll$ILbH9u@HHL"cÅu,H=EHt` Vt$H0IEf.IEHD$dH+%(=H[]A\A]A^A_1111fDH=HHHH5`xLjIH赶IHtH$HH^Ru*HH5vnLnVfLL襋tLeLORtH5qvHGnMufDHH=H51H=H51H5vHm}ff.fAUIATAUHSHH=dH%(HD$1H$pH{@H H-:HH藕H=H`HHH$IcH9|XHLmuH53uH m?+$HT$dH+%(H[]A\A]1111ÐH=HH5D1赳H5tHl1DH_H=H5wHى1vH-GHH褔t`H=HH1H5EHXc=1.fDH=aH5v x6H=3H5v1ݲH$H= H5v1跲fH= H51蛲5uYH=r 11Ҿ lVH=11Ҿ WV1hHH=: H51D1EDH= H5v1#輂ff.AWAVIAUATMUDSHHHt$I$AL$AIH|$LQ¸u t%1H[]A\A]A^A_1111E1E1fDH=H5u1sHD$AH=H0[H=H5A0C1H=yH51E1 u;Zf.EAwH=JN,IHAUAEAA9s!EtH=H5ĀfH=H5/言AVIH=AUATE1UHSH\Af3Hƕ~3H5aHA9IFqHLt!AA u[1]A\A]A^111fD[]A\A]A^111@S1H,uHH51xHH52mHH5[[ff.fAWAVAUATUSHdH<%(H|$HHt$s}H$HDt$IE1L"ff.HC IHtcH9kuL;LLL[uHC MtdID$ H-4pELHhH{FHgGHHgHD$dH+%(u H[]A\A]A^A_1111H[Lff.AUATUSHH3dH%(HD$1HtpILcfDH[ HtW9kuH;LLZuHCH= H5PrH$1#NHVHcSHIH12SH=H5/r11HT$dH+%(uH[]A\A]1111E1^~ff.AU(ATUSHdH,%(Hl$HH5qPHpHHa{1H觭C1DkHL%nn7{LHLTHc{H5qHH;HCHHH$DH=;CuPHH5HHC 1جHD$dH+%(H1[]A\A]1111H51蚬H;LeH{LyeLHieH=AH5p1K H5amH7eZfH=H51H;L eH{LdLHd |AWAVAUATIUSHVH=H5/N1軞H=11Ҿ BH=F@DH=H5M1{H=11Ҿ VB H=AH5MHɭH߾8H=H5H=CH5N]@3D$H=H56a1蛛H=11Ҿ v?~ HcHD$A)EDD$EMD$ fH=H5`1+H=l11Ҿ ?HN0pIHHHP=AELE1H=11Ҿ >H=H5`1襚H=11Ҿ >HL-?3L5?`P1@!VDIUH=L1CH5LH茔ADžZH3P1@!DHl3tECHT3H6ADž@HcVH=H5_1詙H=11Ҿ =H.L]H=11Ҿ X=H05H LHcLILECff.ff.1Ҁ8 HAH9uAEHff.ff.ff.DA AHcA  uAAAHcA Hyf.H=qH5yK1{HSe!AT$ t 1Ht1H.CD$$MPDH=H5[1胖L6HIIH1ҾiHL$(H9:|$(1L;wL1Ҿ L:LY6LH=KH5Z1Ht$(   9H=H5E1ĕH=11Ҿ 9|$ ;H=H5Z1葕=_x;(H=YH5[1cL5H5cF1HwHPH=H5[H1#RH=H5Z1:H=;H5%D1H=&11Ҿ 8HD=h|$ :ZJeH=H5Р1HT$`H=H5|1觋HD$(E1HD$E1HD$8HD$HD$0f.1 otpt|$Lu H|$x`D E |$\DEH5 )fH=H51?fDH5IH=1ˊH$ a@HD$H1T$ hT$ H1HD$ DŽ$ bh 1HkD\DŽ$EH=H521hH$gHD$p|$PD$Pm|$PD$P UL$P1HH$ED$PBH$HHDŽ$_BHDŽ$ng1H$H规H$H5mL$P1HH$ED$PAH$HHDŽ$AHDŽ$fH$H$HLH$H5H=E11/mHD$(|fHD$(mfH$HRjCfHD$84fH$"fH$fH$H+R fDeHD$ieH$HQGfeHD$01eH$@eH$8 DŽ$H$H8@SeHHH$HkH$H?D$PHDŽ$d 1HPh$td 1H0hDDŽ$E=H=nH5LQ1x#dHfkdH$`DŽ$DŽ$9dH$HTP6bKDŽ$rcH$`DŽ$PcH$P>cH$h,cH$DŽ$ ucH$XccH$p0!"b 1H>fH}D$X[m}D$XDbH@}3bH7}"bHE11HH}jjL@HHPHp DCH D$XFbD$XH|<bHD$bH$aH$HNpaH5}1HIr$xTH=[t =pH=H5ξ#H$t*|$LH$H= BBH$Hg H5Qg,HH> 111H+HH?H= H=iH5B#Hl$H$H=@[H=4H`nH5؅H=,oH5%H=hH5҂H=_H=H52H=HHLl$H=H_LHnH=w5LH$0H$8XH1Ҿ6H=I7H=E5LLXH1Ҿ6H= 7H$HH$H=HH5Q,R|$XmH$H=5Ņ)D$hxH=E6$4xH=\$$$ = $Hu=;HtH{$t!$tH$HT$@HT$@$AS$E1H=ciP5$P$RD$$H$8H$0DH5H=H0H$H)H$HHDŽ$(D$PHDŽ$H$H(H$HHDŽ$(D$P HDŽ$BDH=aH551koH=GH51QoH=5H517oD%DEfH= H5 oHH=H5ȩ1n=LD$ H$1L $H|$(HD$0HH$$L65H|$pHD$8HH$t(H$11H$L4H$0E1HD$(H9LD$ H$L |1ҋ$H$6HD$(HH$$Lx4H$IHIH=H57mH5H=yH5ڨ1mE1E1LL$(E1E1LD$LD$ E1H=2H5[>mH=2H= H5zmiH=`H=H5lH=H=H5lH=H=H5u1lo$H=1ɾ}W2H$HT$`H5ÃH=L_l($H=1ɾ42Hj$HT$`H5<H=l$H=e1ɾ~1H?$HT$`H5uH=kH=H51kH=tH=H"fH=fH=fjH=fFH=1ɺ!11ɺ*011Ҿ,0H5MuH=V13H=EH5=jH= H5jH=H511HT$@jHT$@H=H5I=[`H=H5\11YjH=1k2H=H1L2H=eH5vjL%H=^?H-bLPH1Ҿ@H=9/H=%HKLݽ?LPH1Ҿ@H=j/H$HH)H=H7H=H)H=H7H=H5u0iH$H5H=1iH=H$H5fH=H=E1E1E1LT$(LT$LT$[H=E1ҽHT$41ɽHL$HL$H=MH5CE1DH=7JHhE1L\$1E1Ht$Ht$1E1E1H|$H|$HcT$TH=O1ɾ|-HHcT$LH=)1ɾ{-H}t$lH=H5C.gH=oKH=^H571hg=t =tUHH=H$H=H5 ~ gH=HW=H)tH=u HH{H=H5\Ufq1ɺ*b,11Ҿ,O,H5pH=.t$lH=҇u E?|DC@##[fGfD@LC$g^f#G-6H=1ɺ!E+H=QH5¢AH=>Q H9H1 H=H5YAH=  HHdH=X1ɺv*^H|$pH=%t*H|$pA11LH m H-H511dH=11Ҿ |H=1ɺvD*EH=H-1HH=HHyH=}H51'dvH=H5dH= H=?H51c@AUATIUHSHdL,%(Ll$IZ-HRTH1LdHHH1ɺHgHHHI LHH.LDLH$[xHA ǾYHD$dH+%(HL[]A\A]1111E1ÐLH.IHrff.H/E1H=H51bHc= u H=q HuLgDH=LH5I(H1Sb2ff.AWAVAUATUSHH $HH $HxL5E1E1AdH,%(H$h HLH4HD$XH>D$HHw,D$HD$TD$PD$LHD$@HD$8H$HD$HD$HD$0HD$(HD$ f.ItG|wHcH>w͉IuD1DtUMH|$X"DHHtRHR1L{H&HmE1*HH5dH=w1`1E1LfHH$h dH+%(Hx []A\A]A^A_1111E1E1DADADADAD >HHD$ HH= ~HH5*)A]Ds9D$HJf.[9H=lHH5C*1k_fDD$D$TD$PD$L;=HD$0+=HD$(=HD$ =HD$@<H{>fD<HD$8a<H$RfL11E1QC@<HD$)f<IADA1L|H$Hxt$MtLH&TH|$tHt$H127HT$@Ht$8HW[HHߋD$\PLL$@DD$\HL$0T$`Ht$8ZYD4Dt$H1E1H5BD1$Icξ1HHL$ E1HD$l$Hl$Dl$(Y@LA'LU8LrH5,4H= 0L1$HL$H9H4$H1IHHsLl$`1H H/L-L"LLHY HIĺ LLCH=A'1IJLN t=1=@Ǎ|*PHMWDl$(1fLDXfɿA*H5^EtLIcHHH1E1"HL$IDH5ʧDH)HHD$ H1H=CH4$H1bIHHL$HtLHl$`H`. 1HJ…HLW HLLL;SDžx1E1E1!Lcl$HH=%J,(C1BLl$TL{LRDžxLArH5x32H=l7.1p!H9H4$HL8HHL$HyLl$`H5- 1LI…~sLLVbHIĺ LL"L t=C1=@Ǎ|*/H=_rl$H=;H5U$1@YLl$׿fLDXfɿA*H5^6EtCLIc1HHI MDH)H51H1L5N)1H50H)1H1L@AWAVE1AUE1ATL%WUL1SH+HHdH%(HD$81D$0D$44D$$HD$HD$HD$(HD$@ADžEGA wJcH>@5HT$0H"uDHT$H=11H5wAE1WLHkPHD$8dH+%(HHD[]A\A]A^A_1111E1f.k5HD$?ADž>fD1:a\$0H|$rHH1Ƀ11HYHHH#HMFHHD$Ht)HH Ht$HEEu E1T$4H|$(wL$ IHEEL$D l$$D$4=HL)vH=H5!AUXDmD@ED$$fDuD@3HD$(3HD$3HT$4Hy@LE1E11(:1<"AE11H5-H=^-H6AHHH=H5 1UAE1pH=H51TAPH=̯H5 AE1T/HH D$$L$^HHLL$vL$HD$4=]HL*H=6H5R BTGH=f+HL[ HLH=H51TH=H HLJ{s$H5L/$f.DAWAVE1AUL-ATLE1U1SH 'H(dH%(HD$1HD$0D$ H$;ADž+AIA@~AwHcH>AAuL11E17H=LH}SHMH|$THD$dH+%(H(D[]A\A]A^A_1111DDx511A@0IM0LHH$H5Mf[0HD$ Ht$H&u_ff.@H$H5ÛH=֬111AQ+MIHXkf.H|$D$ pLHMpHHHHHH=LHbIzpHMypHLLHILHHH#H=H5HHH^HD1PHHH=ǫH5GH1PH>H=H55H1PH=H5c1PMT$ toLHH|$4IoHLLHILH8HH|$U4IH=L11H5}APH=H|$4H[H=H51O5` UHSHHy +t u uHSH[]11fDAWAAVAUATUSH8dL$%(L$(IHDŽ$HDŽ$HDŽ$HDŽ$HDŽ$HDŽ$ DŽ$DŽ$DŽ$!nHD$(.HD$HuEH$(dH+%(H8D[]A\A]A^A_1111E1E1E1E1DH=+L=LL+E1HD$@@HD$`HDL5"H$L-!DŽ$D$\DŽ$DŽ$DŽ$HD$hHD$PHDŽ$HDŽ$HDŽ$HD$pHD$xHD$8HDŽ$HDŽ$HDŽ$HD$0HD$HDŽ$HDŽ$HDŽ$HD$ HD$HD$Hff.5'|(wIcDL>fD==~/#wIcL>D=DE=@N#wxuxfDHt$*tH$[D$\Kar91H=HH5(@HT$`H=,H5 16LE1HD$PE111HD$E1E1E1LHL$(H$H|$}H|$H|$ LH|$(LH|$P}LLuLH|$H$>LH$LH$KH|$@HRH$ELH$ H5DH|$H(hDL/Et Av AvfDEt AS ASfDEt A"W A"fDEt A AvfDDŽ$`DŽ$P(1ҾH HD$@2fH H$fD@̀DD xEt A5J A5VfDEt A$A$6fD,HD$h!k'H$fDS'HD$f;'H$HVfH|$0t[H|$8 H|$Ht$8H|$H|$ Ht$0H|$ `HD$8&HD$0NfD&H$6fD{&H$fDDŽ$K&H$fD3&H$fD&H$fD&HD$pf%HD$xH|$8tfH|$H\$8H|$H\HL$0HHHEH|$ HD$0Ht$0H|$ %HD$0m%HD$8[%HD$PD$\>%H$,%H$&HGf.$H$$H$&H|W$H$^fD=FM$H耲HD$HH2HD$PE111E1E1E1E1HD$')A)I;pADžH|$PtH|$PH$fH|$hH$lEA@7H|$0H|$8I H|$Ht$8H|$VH|$  HD$0H\$8H|$ HHEH$H|$p11H$ 4zAS@ŀt DŽ$H|$ HD$8HD$0H|$11LxH$VC HD$E1AS= E1L\$LL$PLL$$rL\$0H$8L\$0HHEcH|$(H 'L\$0HH$ $= = H$HL\$0L\$0HL$Mt:H$L\$0LH5_L\$0HH$I$wL\$0H$HL\$0HIzA$ AhE- AS+ H\$(E1H\$Dd$8L\$0H|$DH|$ DIL1ɺL1I6IHh LD$@$1LH$ L /HH7 H$AHLH$/HH LAcCH1H|$/D98Dd$8H\$L\$0H\$(H$AS HH$Ht#H$H5̧L1L\$(,BL\$(H$Ht#H$H5L1L\$(AL\$(H$Ht#H$H5L1L\$(AL\$($=B L\$(=  H$HLL\$(E1 E1E11YL A5t*L!LDA"tLOA$tL6H JHT$`H=H51ALA$tLAtLH Lo A5t LA"tLH L? A5tLA"tLH NL A5tuLoA$tLVH ClL1A"tL<A$tL#H @k;HD$HQK;HD$H v+;HD$ HKV ;HD$ H6HD$H D$ EA"Au EH|$p11H$ 8qEA D$A DŽ$EDŽ$H|$VHD$ l$HD$H|$8H|$bH=H51>RHD$0H D$xdH|$p11H$ l࿁t DŽ$E1H|$A >H|$xHA" 11L١L\$3L\$HHD$P HD$ H|$0HD$ILD$@H$ 1L $H|$0L\$`L\$`HHD$E1E11E11AH=qL\$0HL$(zHL$(L\$0ZH|$A HD$8HD$0E1A H|$11LH$L\$PL\$PE H=E1E1E1L\$(A1L\$(1HD$PHD$?E1L|$ L|$H=H5=1H)H$HHEI~IHL1ɺ1HHu1I1HH\$ E1E1E1H\$A1Hl$PHl$E1E1E1E1Ld$ 11Ld$E1Lt$PE1L|$A!H$"H|$Il$*1L\$HD$HD$ SE1E1HILL$ AE11LL$E1E1LT$PLT$UA E1H|$l$t1HT$ HT$H$1E1E1H=H5ؖL\$(A2L\$(1H=fH5L\$(m2L\$(FE1L\$LT$LT$ Ht$LL\$( !H$L\$(HW1L\$(AE1H52L\$(1g1E1E1E1H|$ 1E1E1H|$ALD$P:L\$HT$8HD$(1H5H=L\$0E1A1HL$(L\$0f.f.f.f.f.fHH5H111fUSHdH%(HD$1HH$Åu,HD$dH+%(u^H[]1111E1E1D31HHt H4$E111AH1HaH<$1!USHHHht41JH[|H4t tH[]111fufDATUSHdH%(HD$HH$HА tF1Iff.LHH<$SH$t 5t%HD$dH+%(uH[]A\111@ufATUSH.dH%(HD$HH$HtKIH1LS~vff.@H<$H$t pt(HD$dH+%(u6H[]A\111tLHff.fAUATUSHLdH%(HD$HHЈLt?1Iff.fLLHH$t t#HD$dH+%(uH[]A\A]111ÁuaAUATUSHHSHLLt-1fDLLH/t tH[]A\A]111ufDAWAVAUATUSH(HdH%(HT$HH8HHL(LHT$HHT$t;1L|$Lt$MLLLH~XRt 9t1HD$dH+%(u8H([]A\A]A^A_1111E1DufD@AWAVAUATUSHHdH%(HT$HHH L8L(H$LtA1Iff.fMLLLH~Xbt It1HD$dH+%(u8H[]A\A]A^A_1111E1DufD@AVfAUATUSH0HdH%(HT$()$)D$HH0L@LHt;1I@A LLLH9~Ut ft.HD$(dH+%(ubH0[]A\A]A^1111E1@ufDH=aH5|1d*H=EXAWAVAUATUSHL'ID$Mt$I$IİM$HD$tu1fڏM,11H‹ďMH|tsHL$LLAH|u}Gt .t&H[]A\A]A^A_1111E1f.dfH=1H5=)H=1H=H51 )H=ff.fAWAVAUATUSH8dL$%(Ld$(L'ID$M$HD$ID$HD$I<LLcHD$ I$1HD$ff.fZLl$ M<,11H‹?MH|HL$HT$AHt$H|HD$ ID$Pt t,HD$(dH+%(u}H8[]A\A]A^A_1111E1ÁDfH=H5/'H=~'H=aH5m'H=Naf.AVAUATUSHL`LhLpPtgH1f E1111H|tkLLLAH|t lt[]A\A]A^1111E1fDufDH=yH5@&H=fy[]A\A]A^1111E1@H=1H51;&H=/ff.fAVAUATUSL'Ml$Mt$I$IPtl1ff.@ʋE1111H|WtkLLLAH|Ft -t[]A\A]A^1111E1ufDH=9H51E%H=&9[]A\A]A^1111E1@H=H5$H=ff.@AVAUATUS~H/LeLmHL@tK1ff.@LLLAH|~='t t[]A\A]A^1111E1ÁufDH=!H5F1&$H=[]A\A]A^1111E1f.AWAVAUATUSHH/LeLmtZLuPL`1ff.HEHALLLHEPI1fڄLLLA$H|1~=wt ^t[]A\A]A^1111E1ÁufDH=qyH51vH=Wyj[]A\A]A^1111E1f.AWAVAUATUSHH/ջLeLmtZLuPL}`1ff.@HEHA$LLLHEPӃI<ʻ~Ft gtH[]A\A]A^A_1111E1ufDH=qxH51vH=Wxjff.AWAVAUATUSHdH%(HD$HD-ֺL`Lx0HEAE1D=tN1ɺ Hڂv!t1ɺH}11ALLH>=Hl$nt"1A HHH I .LLHH6hDHHLH,At t9HD$dH+%(HD[]A\A]A^A_1111E1E1DA@11HHgDHXH5 nH=ZvmH=NvaH5$H5H5mH5H5ff.ATHfUHcSHH H=uAH5D$HHEfIcf*D$HTmH fHP* HZ^Y H[]A\11111f.HH5r1OH=0uCٷH[]A\11111fDAWH5:AVAUATUSHHdL<%(L|$8L?Iǐ8Mǐ(VfH)D$)D$ tU1Lt$Ll$@LLHA LIǐ8HD$v~r,t tCH5HWHD$8dH+%(unHH[]A\A]A^A_1111E1lf.H=sH551H=s~nt@ATUSrHHhLtG1ff.~HdHLHct8*t t[]A\111@ufD[]A\111fDAUATUSH}dH%(HD$HHhLLl$1Ll$ff.}HHLHcDLntA111LF}L8t t}u-LHLu-H={ HsH}Hg H_HHH[]ff.UHSHH>+H#H}HHHHH[]ff.USHdH%(HD$1HH$Åu$HD$dH+%(uIH[]111HHtH4$H1CHH<$]VfDATIUS1HdH,%(Hl$HH$strHHtZH4$E111AHt5H~'11ALLvHkuH1H<$=HD$dH+%(uHH[]A\1111E1E1~ff.ATUHS¬HI Mt"~ؙu6[]A\1111ÐH=qkH5G1{1[]A\1111@LH=AkH5cH1H1@AWAVIAUIATIUDSHHN/IV/LLH(I$HtoHiPHHH fI<$HHHt0SH5.mtH[111D1D$D$H[111fAVAUATIUSHY%Ia%HH覰IHLLHHtHkHu[]A\A]A^1111fDHL H[]A\A]A^)fAVAUATIUSH$I$HH覨I~HLLHhHtH+Hu[]A\A]A^1111fDHLmH[]A\A]A^fAUATLcUHSHdL,%(Ll$IH$" HHH9uKH $H9t9uHxL9|;ff.HD$dH+%(u+H[]A\A]11111@AEHHLdH%(H$1H|$HD$HDŽ$H$tHHuA<HuTI@HHH< HttHH$dH+%(u!LH1111E1fDLfDAWAVAUATUHcSHht$(H5dH<%(H$XH<@HD$ l$E1Ld$HIL-9fD|$L/D$HDLC1%IFH9IL}H=XH=]11Ҿ 蓦nu|$HA|$L|$LH|$ H5L?H$XdH+%(@HhD[]A\A]A^A_1111Ë\$Lt$E1Lt$ \$,fDCH|$ H5LLH5H=!U12sH=UH51 H|$ H5NH5AUATUSHhdH%(HD$XH-oL`Htv1Ll$f111Ht_HELHHctjHt$@LHutQt t*HD$XdH+%(u1Hh[]A\A]1111Ddf@AUATUSHhdH%(HD$XHHt$HD$L`NH|$<Å Hl$tH:^LD$E11HADLHc4HZ̕t tK1H|$H7HD$XdH+%(Hh[]A\A]1111E1E1df[HHIt1Ll$ff.Ht$1H1tuW]HhCLHHctU@LHtAƔuD1@ff.@HH= ff.fHH=ff.fHH=ff.fHH=Aff.fHH=Gff.fHH=Kmff.fHH=Mff.fHH=$-ff.fHH= ff.fHH=[ff.fAWAVAUIHcATUSHt$\HT$0dH%(H$1HAHkH52;H5H$Hc1HD$~HH011L$LH˧HKLcH5PL1HHIcE111LHy/HLLHHD$8H$ H߾HkLxHD$ H{McIID$XL5JDLl$HHD$(H-Lt$Lt$@Ld$PHD$0A7H|$ y51ZD-ED-uELt$`E1MMc7<LHߺ HHD$`Hl$hLt$pD$xO_HD$L H߾Lt$pHD$`H$HD$hԐAtƐt=5Y1D$w DHH5D$H=MH HEt$XffHD$IA*OA*^D$HYHD$HD$(I9^Lt$@Ll$HLd$PH oHH=E!L|$(H-7AMH=:HH1I'M9uH5H O$H- LD$ 1H=GHAH=GHIM9uH5G fL|$8H<$2L`H|$3LNHH$dH+%(H[]A\A]A^A_11111E1ASfDH<$J~FIH HDffH$Ht$HB 0zD$XwH=|1,몋6H=cKH5w1mH\$\AHD:H=GF2H VFH=OH-aL|$(AMH=.FH1IM9uH5F K,L-6L%&HL$ 1H=EHAH=Ef/v:L^II9uH=f+LnH=D@+H蘴MH=JH5D1 HUHD$8H=D1*:H=1*H=;D1*H=*tIfAWAVAUATUSH(dH%(HD$1HD$-!HA@AAHD$HBL%H$L-H-1H51HHH1Ҿ>DL1H.L1DIH|$1ҾI H<$1DIH$HMMMH<$/IHtwLH5HtLH5L1HH9AAHD$H!L%:H$L-/H-(1E1HL{HL LLH<$H*HD$HT$dH+%(H([]A\A]A^A_1111f.H9AAHD$HL%:H$L-H-(1@H$H51LՈ1Ʌ HH5qL蹈LH5L蟈L菻HHD$H)HL$HD$Ht$HHL$HL$AWfE1AVAUATUH-kSH1HxdH%(H$h1)$@)$DŽ$fD$f$H&$O)$ HDŽ$HDŽ$DŽ$HDŽ$DŽ$DŽ$Ƅ$HDŽ$HDŽ$0)$)$@)$)$)$ )$0$O)$`)$p)$)$)$)$)$)$)$)$)$)$)$ )$0)$@)$PD$$ HD$D$Ƅ$Ƅ$D$XD$0D$ D$D$8D$PHD$`HD$Hf==,= wH"HcH>wHcH>uH=C@HT$H=CH51HT$H52H=C1H=C貐HD$0E1L-HD$8HD$D$@H$D$(D$$H=NNxLE1L=yOH= NyL;H=[|tK<{LIL;5<|rH<$tH5H<$1H=nL5et&I<޺LHˠH;mrMtH5&L^D$ t;D$(t3HL$HiېPLaLfI<$IĐPPI9uD$@OH|$LMH|$8ÏH$fH|$0H|$HrH$hdH+%(-&D$$Hx[]A\A]A^A_1111E1E1E1E1HwD$$aH=AE1L-D$$觎D$@HD$0HD$8HD$H$D$($Yd%lwH$H7H$x;Ƅ$YH=E1gHH$;HH5QH HzfHEu PCuPH-yHEHnnL5HEƄ,LH=߹HyL=vAHyLIH=HCƄH\yLH=IH=yHCƄH*yIAH<$茔A9H<$DwHHH5RHH-xHEHn HL5LkpL=7u DH-xH;HELƄ,HHx2IL9uKBD$ =/|HT$H=>H5q=DED$$製D$8@fHT$H=>@1H5fD$P35$OD$0HT$H=O>H5z1Yh@kHD$`HMH#8Ƅ$IH.H蹱`#Ƅ$\H-XHItD$$H$H.!LD$D$$:D$X|HdNHD$HHAƄ$Ƅ$f蛀H=<E1L-HD$@HD$0HD$8HD$H$D$(KH=GzHT$H5:H @HEHnx HƄ,L5L=r茄H}uLHHCHguI8LH7HFH5H<$1H=MI%LH5H賔L$$Hf@H<$W9BH<$DH,H5NHHH5HsH5HH5HH5״HnH5_HWH5H@H5H)toH5Ht\H5EHtIL-eIEH=Q L%HBƄ,`LHeL=]ZKL-weIEH= H@L%LspL=N] @L-AeH;IELBƄ,`HHeKL9uȃ8HeHSH! L%,HCƄ`LH=AHdL=\LIHdH=HCƄ`HdVIL$$H5ҵL D$hH$c;H$HH H4dƄ$L-L56rHD$(HݲHD$@H-ffDHuH$HL9uE1H5FHuAAfD$JH5^HپuAƄ$DAfD$FH52H1觾@D D;AruH{suB{au<{L%'I4$HdIHqI9uܺH5ɱHhu8{L%sI4$HIHI9uAduD{su>{au8{H5HѽH5 H躽H59H製uƄ$Uf$SH5HvuƄ$Xf$VHt$@Hvu5{L=!I7H%IHbI9uݺH5H)u8{L=T@I7HռIHI9uH5\H讼HH5KH藼ZH5<H耼rH5QOHiu Ƅ$H5 HIMt>E1L%k IM9t)K9LHH9u~"t IFA.H9t(hHH9uH_HtKL$`1LLL>9LHH9u~"t IFA.H9t(hHH9uD$P$H$H5S3He@D$ H53D$@PD$(H5 HH1HHD$D$H$#=D`@HD$L-ݩLpD$(H$HiPH$I,D|$ EtIHWIcLIƐPHLHIHcT$8IIH5mHHID)IxHfHnflAH5CI H59I(kH5/ISI I9l$0'HD$D%uLp H$M,.I>H1IƐP艉IxH1xM9EtI>HOI>HDH=1H501H=1~D$@HD$0E1L-HD$8HD$D$(D$$2H5Hз]]HT$HH5~H=R11cH=D1W~EAƄ@l$Ƅ$f$AD$ƄAD$ƄAGƄAGƄ 0fnHfpH$0)$ DŽ$DŽ$DŽ$Ƅ$TfnHfp)$H$f$U1Ƅ1Ƅ[H=/D$@H5.1L$$H=/|HD$0L-٣HD$8HD$H$D$(D$$H=8/H5!.1L$$>H=/2|D$@H= /H5-1T$@H=.|%D$  \$ HHID$@v HiېPD|$(H=.H51L-D$(HD$0HD$8D$$H$H=b.u{HD$HHLHH $HD$Hi$PHHD$H2LHLH3L13H$fL|$I>ITI~0KI~hBI6M9uH0>LL薋H8?L肋L<$I>IM9uHLڿHοH¿H趿fDI>I褿I蘿M9uL@ff.I>ItI9uH;'H{H{H{ H{ HtNrHtH1H{ H{(Ht*rHtH H{(H{0E1LPaH=ettI>IIоIpľI踾IPkL$IlLI@mLL;=erE1H=VtOfDJ SJ(FJ09JHsLI蠉L;=VrH{8uLHÐPIĐPxHvLdHD$H$PHD$PH9H$E1H|$`1ҾvDL$hD$IHD$8H$@HD$`Eu&$YD $\ $ $DŽ$HD$`H$_8$HH9u Mm' H5D*$@1L5Y5L-J5L$=59spHJI>4T$ÿ5515HT$|$ L551D$0D$01ڋ54ѳy$A41L-4L$49swHH=4T$51(5HT$|$ L5i51D$0D$05,4ڿ r$B41L-w3L$39swHH=4T$d51w4HT$|$ L65T41D$0'D$05{3ڿor$CO31L->3L$139swH>H=W4T$賽5%13HT$|$ L531D$0vD$052ڿ辱r$D21L-U2L$29swHH=4T$5t13HT$|$ L5V21D$0D$052ڿ r$F11L-1L$19swHH= 4T$Q51d2HT$|$ L#5A21D$0D$05h1ڿ\r$G<11L-3+1L$19swH+H=d4T$蠻511HT$|$ Lr511D$0cD$050ڿ諯r$H01L-z0L$m09swHzH=4T$5a11HT$|$ L5C01D$0D$050ڿr$E/1L-/L$/9swHH=4T$>51Q0HT$|$ L5.01D$0D$05U/ڿIrEK HD$$JLLt$0t]H$LL%ϞH-nM,LHTIH . .H;HÐP襘L9u쀼$KtbLt$0H$L%fH-InLM,LHIH R. h.H;HÐP9L9uH$SE1HD$hLHL$hE.<)HHuH$VE1HD$hLHL$hE-<)HHuHD$0H $- L5Hl$L, -nHcЀ@tLd$0L=5LI ԿH,L%yYL5>k1(Z:`A$AڿA\$AT$H5fAL$[HI IHaHD$x<tߋ(Ƅ$AdH$*H5kHH=H5HD$8L-$D$$HD$05H$٥H5ɖHHH5$1Zf'D=_EA|$At$H5$Al$A$$jbZ R^A^^^BZHT$H=H51y&L%xX1HD$X<tMD5&Ew-Q^EHA$ڿ AL$H5YHCIHuL%iL5T11&MLD]ENAAڿANH5=FYHIIH;H$<tD %Eu=|]uA^AH5B# ݕIOA^^X襝HT$H5YH茝HT$H5]HHvH5Z"1~XE1D$%D\E TA\$HH5?"A$f(^^#XpHH50"1X$$1T M\ ɔHZTA $ڿH5^WHIHH$<t5/$u kHS[f(^ЅuIL$A$f(H5!f(¿.WIƐPM9Hl$1L%># #DH #H=4T$ 513$|$ HL5vA$1D$hD$h58#D +%#L$#9H5V)$Po$H$p)$`H$Ho$$xo$H$$cHL$o$H$PH$DD$(H$H=)$o$H$)$oH$HL$0!1L%o!L$b!9swHoH=4T$5V1!HT$|$ L趯58!1D$h觶D$h5 ڿ rHD$HH$L$H;HÐP$oL9uH|$0=HDŽ$lIƐPM9Hl$1L%\  r DHy[ H=4T$5Z1 |$ HL輮5>A 1D$h謵D$h5 D L$9pHH4RMHH51RaL5ML%d1rHD$h<tHabMW2MAM$ڿAL$ ANH5oRHCIIHu$tB-Vb &MMLT1ҹH5ERL%`1HD$p<tUDEMD9VEL HOAL$ H5^QHIHuH=aLD$L=I>1L$AL=UAAWڿAOH5QHIH;KA<tEuDHSHH,E1H1H5P=U[o KH ÏqKH5@f(^^_PXH$H==HD$0D$L=1L$`AL{TkAAWڿAOH5OHIH;<A<tEuߋ gH4H,؅,덋D$$fnD$H$ L-$fnfnfbfbfl)$ fp)$0fpfք$@vH$HD$0SESD$$`HH51O5cSAoAHH5Agċ ^^^NHzH51N(RcAoAHH5Ag?- %^^^N9H$HD$0D$$L-5Ld$0H $L=/L5M, LILHHHL$pI<ĢI$HMHLH;HÐPL9uIĐPM9t Hc 1L%fDH4HcT$I 5  tދ<芶HHtGLd$0D= H1VKID$I$ IHt #Yu H=H5 1AH=LJBH=H51蕤H=vLs BƄIj HO[L%CLPH$ LHDŽ$ HyH$ zH$ A7AD$YHH5$zHH HHzHH 1H$\H 1HHH5ހH6cHH$P H yHIcH5_;{H޹ H$xHJH޹ H$H$DD$(HL$H$PHH=w֒E11L5"D%L$9szHH=4T$X5ʛ1k HT$|$ L*5AG 1D$0D$05nDaEoT$(Ht$HH9~H$$Y E1E111H$H5ADHJH$Ht cH$Lt$XH$vH$H$E1yLAH$E1L$ELt$0H$D-C1RKDIFI*I|HgU{ INA$LIvI|>RH$IƐPI9uL$$IL%*H5yLHT 諑51^|$ HH5`5Lc81D$P eLH5rD$PH=FHL =HHD9#fH 6A*^D$PHIH @D-H$1QKIƘHZ莟MINA$IVPIvIƘh HD$IƐPI9urL$$L5NH5{xLHT P5b1|$ HH5%5BHcIH$1D$P襚<H5qD$PH=HH$L H\HDΞ fH5A*M^D$PH\$PHHD  H$1H$ PH$IDxIEIEPI|xHP/IMA$LIuI|xnHD$hIŐPI9oL$$LIH\$PH5vHT Ύ51|$ HH5}>5Lc[1D$P.L=;;H5pD$PHH=]L HHD\FfH 4A*L$^D$PHHDf H$1HT$PNHT$PIIEHH$IH葋IMLIuMEXIhHD$IŐPI9jtL$$LH5iuHT Y5k1 |$ HH5.{ɐ5KLc1D$P蹗LD9H5nD$PH=HEL HHDfH 2A*^D$PHHDIq1yH$HDŽ$H$1HD]H$MDjtH@H<4HHtELt$0D=H1LKIFIIHt /O H=H51A̚H=BV8H=H51衚H=B%8ƄI.H[QPIL$ALIt$I08]H$IĐPI9L$$L=nH=L51HT$|$ H5w_5Lc|1D$POLD [7H5alD$PH= EHHD耙jfH 1A*Lt$^D$PHH:H1HT$PJHT$PIPIPHmҘ`INA$IVPIvIPEa3HD$IƐPI9xL$$LH=q蜉51OHT$|$ H5u 5Lc'1D$PTLD6H5kD$PH=. EHqHD+fH /A*^D$PHHDHT$XH)H1HzH$ 1MH$L5@Ѐ tH$L|$PLd$HL$pH@IdHDŽ$ tHL$ D%gdJD%J!DdJvHŐv!H@1A|IH"Hp"LLj!L11L$ 1HŀAL$ 4!111HŐFH$  HHD$HŐPHDŽ$ H9Hl$0HMAHuH@H0ITHUH+7!HŐPH9,$uOL$$H=GHkLP H021諊|$ H5kH訅Lc苊LH5HkL=.LH tH5cH=LD$PԐfD$P*H %HH^ HHMHUPAHuHŐg1 hHŐPH9l$uHkL$$H=jiLP H0=1趉|$ H5hH賄Lc薉LH5HkL=-LH tH5cH=LD$PߏfD$P*H5$HHH^LIHt$hH)H1Hf.$L5q8WHDŽ$ Ld$:`Iܠ'`IܨIԠt\HtW1HDŽ$ 蜍HH(H8m~HH@At;NH=|H=H5ke1討H=6+,$H$1aHL$pBQ:tH\$L$HDŽ$HDŽ$,HsH$HJH$H41}HHHlH 5HHtfLHeH$HeHzH$1>IHH6MH$L-)H$1LHZH$HHLZH$1^>HHH誉`H$HR-HL$ 1HLEZ+HLH+ZH$H9$ HHH$LÈHÐPCH$HDŽ$BHHDŽ$cyHD$H9L=3L$$H5`H= HAT |1HT$|$ H5!] HciHH5H=)AL tH5^H=7H$=fH$*ˋ5H !H^ Ht$pHHH)1}DHH9rdfD1AxH=H51觊H=2H'(Phu ]tƄ$$<$1H=`L$H;@tڀ$uH L4HD$H$fLHDŽ$)$P)$`)$p)$)$5Hg A>E A~C (HH H$IV1ɽHH5tL-HH޹ H$PbIjLLH\IH HXg tH$PLZ H$L$af L$HLHH-IH 1HcC  CD$0 H5_LM H$11LH$HH$IaR H$H5C_H$H5=_IHD$PM H HL$PILLH$Q H$HH$H$HH,HHx 1H\f F |$0wH5^HL? H$ 1LHL$HOv H$ H5s^HHxLHHHD$0L$ v~1H$H9$ uHt$0H|$PHt3Ht$0EH=LH5^1蟆H=.H$!$l=fHoH)H12L$$0$1H=< u6ff.f.H; `tڀ$uH L,$L$`HHD$HD$PHDŽ$fHDŽ$)$P)$`)$p)$)$A)A)F $HH1Hgr ;da tE1IHvHLHXHH Hdc EtH$PHV} H$H/] L$ILLH)IH} H8m AN 1H$LLA c"@ H$H5H$ HD$0H Ht$0A LLH$ " fA)A)F9L$H$4H$LH(IH2 H荃" A H$ Ht$0LLA K H$ Ht$0LLA Kp Ld$PTHL$0IIĐPH L(L0H$H8H$ HHH@H$9HD$Ld$PI9;T$$H52HL,$3t1L|HT$|$ H5RGwLc*|=_ LH5ItH5JVHL$H=qL%}fɋT$$H*$SH52ZHk^A s1{HT$|$ H5hvLc{=LH5tH5UHL$H=fɋT$$H*$H5ZHk^ALs1{HT$|$ H5NVvLcz=1LH5ktH5@ULHٸ$H=CVf$7*HkI^ALD= $YH5S111HSHH5SnHE1L$9r aH=pLH5n1wH $XHLLHH H$HH8HT$PL(HHH$7H$PHD$H $H9T$$H50L5q1NyHT$|$ H5~PItLc,y=aLH5tH5SLL$H=sL%fɋT$$L*$UH5VHk^A p1xHT$|$ H5RsLcx=LH5qtH5RLL$H=~fɋT$$L*$H5UVHk^ALp1 xHT$|$ H5`RsLcw=3LH5tH5 RLL$H=EX~f$9*HkI^ALH5IIĨ'yIĐPL9d$H\$ HKHSPAHsHàj 1HÐPH9\$uŋL$$H={HkLP H0c1*lHT$|$ H5I%gHclIH5XHkL=&LH tH5EH=LHڸ$Rrf$3A*H gHH^ Ld$IL$IT$PAIt$IĨ;IĐPL9d$uHkL$$H=JLP H0b1/kHT$|$ H5oG*fHcH$IkH$H5}HkL=#LH tH5DH=I$Rqf$3A*H gHHH^LP'H=H5G1pH=pL'H=H51pH=+_eIfDL]:H=H51A pH= VH=H51oH=n ƄHH5o>H59>2H=H5eE1oEH pED$H y\H5 H5wEH5ԾH5ȾHL->HRE1H1L%byD-L$9swHH=4T$h_5g1{HT$|$ L:c5gX1D$0+jD$05ڿsSrL-=1H$HDHH5K-H$Ho$ HCH5@)$Po$H$p)$`EH$Ho$HrCH5n$xo$H$$EH$Ho$H$)$o$H$)$L|$Ho$H$DD$(H$PH=B$Lo$H$$\>H$MM,I<$1117fIĐPM9u11L-T=L$9szHH=4T$/]5e1BHT$|$ La5eA1D$0gD$05ED8QEoT$(Ht$H]HGiH5{1O1D= EA^AH5I $AT$  Bf(^^酲HhH5ID1 AHD & f(^EAT$ f(ȿf(H5Cf.fAWL=HAVE1AUL-ATLL%IAU1S1HhdH%(HD$X1D$DHD$HHD$PGD$<HD$HHD$0HID$8HD$(HD$ HD$HD$H$RC|wIcL>kHHT$DH4uDHT$H= 1H5jE1E1E11L=GH|$PjL=GL5HML H<$LH|$HL"HD$XdH+%(Hh[]A\A]A^A_1111E1E1ZGkGIQff.1L11HT$HLHHt$PLb?t;-HL$Ht$Du{u1L$L {HIHR$IHH|$t'H\$HIUHHz+)LL ,HT$PLL ULHHH|$ wHHHHH5E1hHﺲ1L=EE1L EHD$0QEHD$(AEI3EHD$!EHE1ҾHH$EHD$ {EHD$L1L0D$8fDD$<H|$1wIHHT$(Ht$0H9_HHg1IHH|$ wSHHuT$<LcNIċD$8L=3DvLH1ZdH=DH5޶PfL=CE116H5CH=11E1L=Cf E11۽L=CH5CLLH=H5C1e:LH,H=H5C1eH=z E1E1L=1CwHT$(H=RH53C1\eH==P L=BHL7E1L=B5H5#C1L=BeH= l$8f.f.f.AWIAVAUIATUHSHHHT$Lt$01HL$ dL$%(L$8MH|$(LHD$LL$ $HcD0H|$%HHL$HT$MMLHHLd$LLOEH5BLHEHL5H$8dH+%(HHH[]A\A]A^A_1111E1E1HH=H1ATLD$MLH5cXZ$H=PLH5A1Wcf1dfH=!H51+c63H5AH=yDfAWAVE1AUIATIUHSHHHT$L|$0HL$ L$dH%(H$81H|$(LHD$LL$ ~_Hc؋$D0L$HT$MHLLIHHD$H|$HHL$=H$8dH+%(HHL[]A\A]A^A_1111E1E1LEHL$L1H=˼H5aDL$H=L1LH5a/@H=H51aD)2fATUSHtRHI1ۀIu4kHEHx;H:ItHpL}BtHEHx9|Ż[]A\111HpLDBtHEHx9}HEHx};H:IuATL%n?USHHY;H=HH5F?HHH11`HLH=l1LHt`Hu[]A\11111ff.@ATAUSHGHHx:HH8Iu[]A\1111ÐH{H>D=Hu IH|tH{H>[]A\AWE1AVE1AUE1ATE1UH-SHH56HdH%(H$1HD$`HD$h4<D$HD$0HD$HD$(HD$HD$ H$ff.GtW|PwHcH>==~ƉrGuff.D$@WB0BHD$8H|$DD$@t M]|$T D$$1HD$ L t ,H|$ HL$hHT$`LDD$0LDD$0 H|$, E1E H|$1DD$@HHLH|$D$ AD$0E1@AHCHx A9kHCDHxn8H:Iu΃|$ u$|$0tHpH|$>ADĉD$ AE@9b*R|$ D$ H=-H5N17]HT$0H= H51]AE11L%;EH|$`oLDD$H|$hpLDD$EDLDD$:H蟰H<$&DD$H$dH+%(HĸD[]A\A]A^A_1111E1E1E1E1ÐHE1L%:1 AE1EEH=!DH51DD$#\DD$f+:IA :I9HD$ 9HD$(9HD$q9HD$a91ҾH,H$C9I3DD$@Ea |$ 1 E HD$P|$ H ALt$HL%9AD$ Et$ Dl$ Dl$ Ld$ALd$8L$@D$DD$XDD$\@H=HH591ZUHH eκH߉L$02A L$0AA)AfDI,$IHtYDEgUHH|$@uAAAI,$IHuDl$ Lt$HDD$\Ld$EDL$DE t$XH|$`oLH|$hpLff.@H=atA HD$8H(HHD$8H=,H516YA FAt6AAH=HH51XD$XHD$PfLL$hHDŽ$D$xHL@HHH$Ht$xHHD$(P_AXH Ht$HHD$0YUHl$H=H$H8UH|$0HHD$p!UH$H$HHH|$pH|$xH$HD$(Ht!HHTH$H H5278茔HL$pH1fHHTHH0uHE0H{Hi AD$D$@HCHx2H=BHH56HD$01DWHL$0HVHCΉL$0Hx1L$0IHIzt7Izt0HD$(H.HH)SLT$0IB(HDl$ Lt$HLd$L$XAEZT$XH=H5$61UAfHt+H=HH51UD$XiH`H=H5411UH߃5HCHx9|HCHx0H=AHH54HD$01CUHL$0HRH=HH51UD$XH{H3D.hHL$E12t$ &Ir IH߉L$8LT$0FLT$0L$8LL$`IJ E1LT$0HIRHD$(IrPZYHLT$0sH=[HDl$ H5tLt$HLd$UTD$X#H=)HH531LT$0+TLT$0&E117MLD% DDD$LIHL9%DD$tHDD$5DD$iMH52LDD$|EDD$RHLLDD$ HKDD$ HHD$9H=QHLH5cWS1AL%1HH=!H52Ld$Dl$ Lt$HSHCH=H5ßHP 1SHlL H$L H$L H$L H|$pL H|$xL H$Ly LHT$H=P1DD$ H5URDD$ H=,HH513RD$XHCt$ DD$0Hx,DD$0HD$PH=1DD$0H50Q|$ DD$0EH=1DD$ H5QADD$ WHD$PH=H501DD$ QDD$ 3H=\H5/-HT$0H=DH51NQH=*H514QL%/E&H|$`oLDD$ H|$hpL DD$(H=ͫ1DD$H50PDD$DEDD$1EHCHxH9}.HCHx5+H8vuVEtDH(EH|$H-)HD|$H豟DD$t&H|$H8HDD$?DD$cT$XcAHCLT$0Hx*LL$`LT$0H2L@HH,H=H5.1OH=H1L$0H5LT$8OLT$8L$0H|$DD$ DD$ HHT$H=JH5#1L%-MO2Dl$ Lt$HLd$CHCD|$ DD$0HxD)ADD$0HD$PH{H-DDD$ DD$ =DD$E,L%-H-LLHGDD$HImHLDD$wDD$H=hH5V.1H-8kNH|$HH軝H=4H5>.1>NH|$H.H:H=H5*.1 N|$XE1H=ڨH5-1DD$L%m,MDD$HT$H=H5d1L%B,MAH=H5ܸ1L%m,Hn,MLHLEDD$HIHLDD$vDD$H=,LH51HDD$ 'MHLLiEDD$ HHD$H=HLH52]L1AL%n+H|$DD$ DD$ HHT$H=H5q1L%0+LAPH1Dl$ Lt$HH=bH5Ld$iLD$X71AL%*GD$XA,H=LH1H5^\LH1Dl$ Lt$HH=H5?Ld$KD$X~H=LH1H5\KDl$ Lt$HLd$H$|$XRfATIUHSHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H HD$HD$ HH5+HD$1$D$0JHLH3HT$dH+%(uH[]A\1111E1E1D@AWIAVAUATUHSHHHHt$0D$HT$8L$ DD$$LL$(ijHE1jH$HMHY^HT$ IŅD$$D$ E1L= H-ʼnI3HHD$HHD$LL$DDLD$H5H1Hy*HtH5HD1HH=1K$t@HAD0L HH@L)$YH=L)RH5DD1H)ZLB:D$ HH[]A\A]A^A_1111E1E1E1E1H51DDHy)H=E`IcL>@$$HH=HfDD$ED$EHf/HE1E1jH=H11_AX$D$EXHH=aH;<@$$HH=#H2fD$$H H=HsH=H5'1 GD$ H$wHHJ@c#L['D$ UfH( H=IH)$;DHH=11H$HxH=11HD$EWH`-H=11HD$E|HH=yH $JSDH=D$ f.t$ H9BH=M`t$$LLHt$(L:DH$wHHD$  H(HHAF$$$Pj$P$PLL$hDD$dL$`HT$xHt$pD$LH@+H$H=aH5bmDD$ vH=AHH5%1HDH=)w͉hP)+uDH=%$D&%H|$ Ht$hHD$X5RH<$HH,H|$(11HT$`HD$`HD$pHD$XHHD$xlHT$pAIHHD$XHH8t$Xt$(t$PjD$\PD$xP$PL$pH@fDT$0X DD$0DHT$H=TH531^A1۽f$HD$ QH|$/GLH=HD$HAMHD$pHt$pH"IHHD$pHD$@@M1H IHMyH i/HIHuuH<$8H "HϔH$HH=11$H|$hf@?LLH|$@LLH<$@L@HH=4H|$`FLeH|$H$dH+%(wHĘ[]A\A]A^A_1111E1E1f;HD$8!+1ҾHHD$fD$4HD$(D$HD$LHT$H=H51>6D$01MH=aH54h>HT$H5aH=81I>HT$H= H51*>HT$@H|$hLS/HHH=MMLL9HHH|$9HHHT$H=H5u1=3HT$H5)HT$H=\H51f=HT$H==H5v1G=HT$H=H5_1(=HT$H=11H5\=-HT$H=ٗH5I1=De=@#wbu@A1L%@@A8A&{ff.19QA#`tH|$0H$ $Au#H|$hHt11H$# 1L葠HHEH=LH515HH1nHHt(H5IHHL,HpUL9%tHAL%AA,A:H|$.H|$(oH|$kH|$  1EH|$L%HELI8HD$0HzD$@H|$01KHD$HTE1Lt$HD$ H D$HD$(HLHHD$H 1HIH1H#IH 1LJSHD$ SHD$(IHH5HH|$Xt;/LHHH)HT$XE1{H|$HtH LH[HHVE1t$0LL$0HT$X_AXt H|$`tDFLH HHP1E1t$0LL$0HT$pqZYR Mt LL"LLr H$Ht-1LHHHH L8 H|$`L|$@Ht$L0A1H5ECH=q+H|$0 H|$3H|$wLE1EL%Ae@QX)HT$H=0H51:2f.1HT$H= 1AH5{L%2HH$2H:H$`LH$dH+%(HD[]A\A]A^A_1111E1E1E1E1DH$NfDLH~}L%z"Hk}Ht#fDH=1L1H;1HHuE11L%f;H$fDCHD$0f H$fDHD$`fHD$HIsHD$XaH$NfDH$6fD{HD$x!kHD$h[HD$(D$pD$t+HD$8D$@ HD$ HD$P HD$ HD$DŽ$pDŽ$`/QH A6E/H|$t H|$ H|$Hr̾HD$H- H|$1L%;E1HD$LD$(Lt$M D$pH|$8wpIHtLHE1AH=AH|$ H|$(LEH|$;oHT$H=RH5ˠ1\.'H=8KEHD$HH|$(HH|$H5)HD$HH1|$@* HD$H H0IH _!IHB NIHt!1H,tLL= H|$-Lc L[LE1E1H=>AMH|$111LELL%H=H5,'H=؇*H|$t H|$(HD$(H D$H|$ tGHD$Ht E1Ll$H51E11HD$HD$H='E1H=@S|$@H$H|$(H5HD$H$HD$8IH<H$H(IH IHHHuLHjH$LH_ H$LLHH$LLHHL$HT$xMLH~HD$HHL ]LLHGHT$PLLH ,LLHLLHLLHLLHLLH#LLH]LLHLLdIH{L`LH=H5 1#*|$pH|$8w褹IH|$tLE1LHAoH|$8wXIH3Ht$HE1AH|$8wIH|$t}LE1{LHA1H|$ L$H|$(1H$MHD$HHHD$0H@'HD$IHSLIH86IHD$LhMLt$0AEHL#Ht$ H|$(LH$W…H$L'H|$LH|$PH1IHrH|$Ho$1H$HHD$@" 1HL$@<D$ 'IHHxL% >L|L$  H5C ))AHc(dHt$@IcHIFHcD$ HH|$L?$H|$H|$0$H|$:H$LL'LE1E1E1L\$LH|$ LhH5 1E1ҿHT$PH=iH5< 1s&E1E1L%H|$H==H5O 1G&H=(;1HD$!HT$HH= H5 1&L=E1HT$`H=H5 1%LHE1[AsE1kIHHD$HtiLHIHtFHLt/E1ɸRE1LL$H=WH5Jt1a%OLE1E1LT$H|$ H$RH$LHOtE1JE1DH=H5<$HH+D$ 1H=H51E1L%;$1EE1L% u1E1L%E1HD$E1E1L%1E1L%E1HT$HT$0H=yIH1E1L%E1HL$HL$0HL$H|$r蟳HD$(HE1E1L%cLL$(LL$LL$E11E1E1LE1LH=~H51#61LLHQE1E1Ht$LL91#1;LE1Ht$LATLHE1CAHT$XH=}H5P1"H=}H5q1"E1E1E1+11HT$HHLvc $AD$Quff.fD$<7LcH|$HDT$@1 HT$(H=-qH5 `17H8[]A\A]A^A_1111E1AD$$nfDD$ VfDD$$AAAD$ D$D$D$D$D$ D$fDH 1H8[]A\A]A^A_1111E1@D$fDD$fDAApD$^fDD$ FfD \$t$1HH5H1ӭEFE&EDD$E|$t$uyL$ u]T$ u%D$$ @H1H5HHHGHD13뫿HO돿H;pH$QH .H5 1ŬH5HH1説 aHJHf.USHH Ht6HHHHt#H=mHHH5[1]DH[]1111ÐATUHSH{uAău[]A\1111E1f.HXH@H=QmH5ʼHTIcHHH=(mIDH511*[]A\1111E1DAWAVAUATUSHXdH%(H$HHDŽ$HDŽ$DŽ$DŽ$HDŽ$DŽ$DŽ$DŽ$HDŽ$IHHH5E1E1H=ZE1Hމ1HLH-AD$tHD$DŽ$xDŽ$tHD$XDŽ$HDŽ$hDŽ$DŽ$pDŽ$DŽ$dDŽ$DŽ$DŽ$DŽ$DŽ$ D$DŽ$DŽ$DŽ$ D$pDŽ$DŽ$DŽ$DŽ$DŽ$`DŽ$\DŽ$$DŽ$XD$ DŽ$DŽ$PDŽ$TDŽ$DŽ$DŽ$DŽ$HDŽ$HDŽ$HD$HHDŽ$HHD$HD$`HD$PHD$xHDŽ$HDŽ$@HDŽ$8HDŽ$0HDŽ$(HDŽ$HDŽ$HD$@HD$(HD$8HD$0HDŽ$DŽ$HD$ ;tGF|GwHcDH>fDH$(D$puf1 HT$H==iH5X1GHD$P1E11HD$HE1E1HD$HD$hHD$`HD$H=hD$ H8H|$NLH|$hLH|$PH|$pH|$HfH|$`LL|H|$(H|$@xHH|$ HwH|$0HH|$8HH|$X軵H$HH$HdH+%(D$ HX[]A\A]A^A_1111E1E1E1E1D=D9=@#8D$ _=FD$H$D$$pHD$X1E11HD$PE1E1HD$HHD$HD$@HD$(HD$8HD$0HD$hHD$`HD$HD$ f. HD$H!H$HLH=fH54H1 ZHK%fDD$$D$f{H$fDH|$ xW1HmHD$ H_f.+HD$xAHD$1 I#H$fD 1H4$HT$H=eH51 >DHD$`HD$PH=iD$ HD$P1E11HD$HE1E1HD$HD$hHD$`HD$@H$H6xfH$HHfH$HfH$HfDH|$0l g1HHHF H|$0wD$pfH|$8d 1HHH H|$8/D$pOf.DŽ$H$H[IH=ocH58H1v*DŽ$ H$fDc1ҾHԮHD$Xjf.;H$HGCfDH$H.pH$HHfH|$@ H|$@HDH|$(d H|$(HD[H$nfDDŽ$X+H$>fDD$$D$!D$$D$ fD$$XD$fD$$D$fD$$D$fDŽ$D$$D$yfD$$$D$YfD$$\D$9fD$$dD$fD$$D$fD$$PD$fD$HL$t$D$fD$$TD$fD$D$tD$|@D$$D$aHDŽ$/H$H/H$D$ H$hf.H$0fDH$8fDH$@fDD$$D$D$$ D$fD$$D$yfD$$D$YfDŽ$@DŽ$0D$$`D$fD$D$$tD$$xD$IHIDŽ$DŽ$k-H$$H$tH$t$$H$tH=]H5(1H|$`11H$uW!H!HLHp1H|$$$$`H|$HLD$XH$1L W$H|$HKHD$`HMLD$X$11LL IHnMu$ Ht%HߺH wVHH H\$hMt/LH HVHD$IHH\$hH$OMH|$HH|$PbH|$P1kHH~ H|$x H$11E11AHHHHT$x1HHB $H|$HT$@$H SH|$BHD$PHHHD$H H|$PHT$@Ht$aH=;[U H5T1=H|$PH=[H5HB$HD$HH $('H/HH脟HD$HHD$ L "H|$P$t)t$!Ht$PH|$@GM1LDŽ$|$H|$HD$`L @t!1H|$PAHH|$蔴MQH$$LLOHD$HHD$H$H$HwdHD$HH$(HtH|$H蹫$ $1H|$0t>H$H|$0ރH|$H+H|$09H$1H|$8t>H$H|$8ރH|$HSH|$8虭9H$H$t$tH=XH5j~1H|$I$y?H$Ht H蛟HtN$$$H|$MH赩HF$HƅtH|$$WHD#IL@[HD$(H;HD$0HHD$@HGHD$8HAH=iWH5w1s'H=OWH5w1Y DŽ$H=%WH5L1H= WH5w1-HT$H=VH5wH1HT$H=VH5vH1cH=VH5P1IHD$`M$H=jVMH5w1kHD$P1E11HD$HE1HD$HD$hHD$+D$EYMhHLE1sML$H=UH5v1H=UH5z1E1E11E1LT$HLT$L\$$u$tH=lUH5y1v$}H|$CH$$LJH|$V|HD$H1퉬$|MHD$`H@1L HT$PLMHD$`HHH|$xtH=TH5w11H=TH5nu1KH=sT11E1H55v1vE1E1LL$PLL$HLL$LT$SH=8TH51v1BD$Euk$uIH$tH=TH5v1 $H=SH5v1H=SH5Cv1H=SH5u1{IH=SH5u1M%+1E11E1HD$h1L|$PL|$HL|$E1HD$ZH$HtHT$H$1LůH=SH5_1H$1E1l_>H=RH5v1$11E1HL$HE1LD$HH|$`@HD$ Ht1H]C111E1Ht$HH|$iH|$PE1DŽ$|D$HH=!RH5"-DŽ$|E1D$H=QH5v1H5gq#H5qH=QH5u1E11HD$HHD$HT$xH=QH5u111E1HT$PHT$HHT$HL$vH-H"HHA/HHEHl$xB1-E11LLL$PE1E11E1LD$PLD$HLL$]H=PH5Fv11HD$PH|$ľRH|$腼5MH|$ $$ $0HD$HH$Ht$ H|$_$|M@HT$AE11H$H$HH$*Ht$`H$HHt<$u2H$HHL$HT$xHH$7H|$$ $H$t Hv$#H|$`H5ux$$$tQL|$LVHH$֣R$ZH$11LH$OHHL$H$LH$L$1MIH1H$$$$9$$H$HHßH$HH$H$tH$rtHLsuH$LHGH5sH=M1LH$x~$L蹻Ht.L$HL聵HT$xHLHίHL$(H$HHt$`R[$u#$H|$H$E1$$  |$D$xIL$Ll$H$LH$L$L$OL$x9$d]L$x9$L$x9$X\D$x9$k9$L$x9$L$x9$$gL$x9$tLL$x9$\1L$x9$x L$x9$T L$x9$ L$x9$ L$x9$U L$x9L$t L$x9$[ L$x9$PcL$x9$` L$x9$pD$xD$x9D$L$x9$LH|$H5[H2H$@мH$ӭH$$$@tHt$`H|$Nt;HD$H|$ H$pTHT$xH=JH5pH=JH5E1H\$h1E1Ll$P1Ll$HLl$E1yH=^JH5o1hMLD$XH$L D1ҋ$H$`vIHt^H|$HHt3L$L11LD$(H$H|$NH=IH511@t.L$LD$(1H$HT$`H|$M1c$H|$htmHt$hH|$$QHT$E11AH$H$HH$H$H|$IIH ^I?T$H51IHH\$ L-ܸA~AFIcDL>fDH^1LHD$ff.1HLD$HE~LD$HL$H)HL$1HDLHt$Ht$~HIH)ƅINHQHL1HcI?H ]ILH5LOT$1I(A$IHH$dH+%(ZH[]A\A]A^A_1111E1H1LHD$fDH1LHD$fDH]1LHD$fDH\1LnHD$~fDHx1LFHD$^fDH\LHD$;HL17fIIAN1HTLHt$Ht$SHIH)F@H5<ҭfSHH \H51HLdH%(HD$17vS;H 0HcH>HD$dH+%(WH7HSH5H8H1[HD$dH+%(HCHHf7H5H8H1[`HHH>7H:H$H5t11HD$dH+%(H[11111E1f.HHH6H:toH$H51HD$dH+%(u[HS:HD$dH+%(u;H6HKH5hH8H1[H51j4f.fDGATUHSL&HMt՘LHZuCHSHHs[]A\[]A\111HH=xH5zuHxH11ÐSHHOHtZH=kxHHt֙t0H[111ÐHD$Ht$HH/xHum1fkHH=fH1yH5H81@AU@ATUSH8dH%(HD$(wwXH:HcH>@HD$(dH+%(H8[]A\A]1111f諷L%\LHHQIH=H訂HHH@HD$KHHI9r(5ff.ff.I9tHHDJ uCDB t4HCff.ff.@HHD$H DJ u:LHHP1A}IEHT$H$:D$HH5)H!ÅWD$ LL;{fDKHcHHD$(dH+%(8H8H[]A\A]Jf. HHt 1;HDHHD$(dH+%(H8H[]A\A]鬎@õHHD$(dH+%(H8[]A\A]Wu1HD$蒡HH=hd1H1vH$gH=dHH11v@H$LLl$zH$Hl$"H=+dHHH1Kv1off.@tDUHSHzHt HHHåxH=gttDH[]1111fDH-A1HH51H}DH};~H=#tuH5HHtHuH-0HH5H}H}X[]}ff.AWAVL5DAUE1ATAUSH @E!AH=sEH=sD9DA'HH<:t u{fDuGHH蚤yH70H1E1H5H;8H;0}vHHHSx/CHkG<:tHCHt<:tfL=/HL1I?I?E1|距HD[]A\A]A^A_111ff.@H=urSHt-t0H=Yr[H5XH=r[111H!/H51H;(H;1|ff.St[u@H=qHstHیuHHHHq[111fDH=qt.蹱H=zqHڒ[111f.HLqHu1[111DAWL=AVILAUIATUSH(dH<%(H|$H׺^H:HHE1K|HHtHH$IH5ƿHAuXHDLLAպ}LH觋HD$dH+%(H([]A\A]A^A_1111E1H5RH衳E1uAHtHHt$DD$ HD$THrLH!HLd$DD$ G誢[fAUIATIUHSH|HHt;LHFtrHLxH[]A\A]1111Hy,H5}1H;H;H5_1oH1[]A\A]1111f.HvH),1111f.AUIATIUHSH|HHt;LHftrHLH[]A\A]1111H+H51H;H;H5f^1H1[]A\A]1111f.H(uHI+1111f.HHH=/f.HHH=f.f.fDH8V1ff.fH?0u H?0tHv>0uff.H>0tҰfATIUHHSN11H肋HMH5}]HHC*HH81NH[]H5JA\6fDAWAVAUIHATIUSHHrHAtHIYLLHKstH HHLHO:tAPt H[]A\A]A^A_11111HHL[HȻ]A\A]A^A_H(飨H?0u H?0t邨fAWIAVIAUEATUHSHH>LLH1IE1ȱHt5HHhzLH踑Aƅy1EulHA>HD[]A\A]A^A_1111E1ÐLmHIkHSHDtLfHHE1mvH߅A|f.AWAVAUATUHSHL~ MLHE1HIHt 1H螨Iŋst1HSH31PH'E1H0DKZYCޟHVIH*LHHMtL1Ҿ7HvH7uLHپmRpHHL[]A\A]A^A_陙fHju HHteuCHHu7%= =H[=t}{H胚HkHH萘軱HH[]A\A]A^A_1111E1E1L`1@H=tAHJZ=uH<&H5``H81CnfDHZHYHaYff.@HLH5Ԝ1?ff.@I>(aH1N{JfێHH~IHDHHHE1t$LL$HTA[ZVHE1Ht$LL$LTAYAZL5fHH51I>j5DKHH}HHE1MtlL^AL5LH5l1I>fHE1Hǹt$LL$1ҾS_AX@1Ҿ?^f.L5t@Hv(H(Ϙff.@AVIAUATUHSHHdL$%(L$I{cIHHgcAD=IHHWH1I蘦H5dL pHH1LvHHHHA膙H55HגMtI,$1HaHmH$dH+%(HD[]A\A]A^1111E1=9HHI&9H-1H}E11^x@H-H5;1H}DH-H5F1H}׵pAVAUIATUHSHdL$%(L$IaILaLHaAAD9ALցML-HHL1I1MH$HLH̤HHakyhOturHLAkH$dH+%(utH[]A\A]A^1111E1fDL%H51I<$觴I<$\1L%{HH1H5עI<${H=vL%IHL1H5I<$IH=MvHHrjATIUSHt`1ɺHܟt0MLH1sHÉ[]A\1111D1ۉ[]A\1111+HHt1ɺHoÅtMtLH12sHH贑[]A\1111D[]A\1111ff.AWAAVIAUATIUSHdL,%(L$IHH H5OLlHMt 1HA$HHHHNo1H茌IHMtI]1HmHiH$dH+%(HL[]A\A]A^A_1111ÐE譋IHtUHHuL- LH55CI} LD1I}E1Y\L- L- H51I}DZDL- LH5BI}覱@L- H5C1I}臱 SHH1LH jltvu[1111E1fDH{LH H*%luHCH H5BHH(HP L@0H;1/HCH H5nBHH(HP L@0H;1踰H;X1[1111E1ÐAWAVAUATIUHSHdL,%(L$I\LH\Á;L$H1HLL$ʟMHHL1讟MHHIH1蒟L%]HLiHHIuH舌HH|LLhHHAEH.H5"H߅HEHE1uHM|H$dH+%(uWH[]A\A]A^A_1111E1H H;!W1DH H5C1H;fAWAVAUATUHSHH(dL$%(L$IZILZHIZC.AD9ALց\L$Hپ1HLL|$MHپH$L5œLHH$1۝LIHH$L$HHD$1讝MHپL%IL1L菝L1IHLwLH dyHt HLc H4$LcyGtuuH|$LcH$dH+%(H([]A\A]A^A_1111E1ÐH-H5[1H}H}U1H-H $L1H5FH}H=+nLHcHLcH-LH1H5H}觬H=n4}H-uHL1H5њH}uH=ynHLbBH-:HT$L1H5H}8H=y[H{HdHHHߺ[]d111fHtGy?E~HFHHHuH@@HʺE111111111D0t1D1111AWAVAUATIUSH(?/t$HL$"nH$H"Ml$H5L輧HH\AD$A1<=Iff.ff.fLIIAFAEt<=uAH;AAEIUHلu#O2HHP@H@qt.fH 5I@rt#H @wt@aH HHEH-dHH51H}gf{j@rtPEuHtQH[]A\1111E1DHD$rHD$H[]A\1111E1D f;08=@rH-H HH+H5@HDH}1貕H}=H1[]A\1111E1USHHHt?tGrHUHHtEHHHH'bHH[]1111DkH1[H]kp1HH[]1111@SHtH;H8uH51הH1[<@HH5cw1跔H1[ff.US1HHt/11fO~NHqH[]111HYH8HHt11HOH-H5)1H}H}H5H>R2H5H=;f{d{:H 1HqDž1dH..H0VH踀H5.HHP]H-HfDHI@_ÃtH=-=:H-  L8HtWH5|LqH$dH+%(_H[]A\1111fDH=Y-H`HHdHHXH$dH+%(HH5|[]A\݋DH$dH+%(H{fDH5$HpHfH8H,HHHnH5~H81u1fDHH5b+HuGHN,HHRH#HH5<~H81'1H߾:c7HH:Ht H)HH53#11LDHHH5}H81轍1%fDHH5j#H81蘍1HqHH5"H81u1fDPHH5"1T1H7H&H5{H,+H81"1]fDAUIATIUHSHHHHtx#nu'HIEHfD1HIEH1HHI$H[]A\A]1111Ht;1tIEHtCMtI$H[]A\A]1111fDMtIEHy1@HfDATH`XUHSHHdH%(H\$HHH$HD11t:H$HtHtLHT$dH+%(H[]A\1111HaHH5_!H81eL%AH5b!I<$IH5JxHH$HuI<$HH5n!H$d[ff.AWAVAUATAUSHHH$HL$0H|$ T$HH$8H$H$PLD$@L$@HD$H$`DL$4L$XL|$HD$dH%(H$1诩HD$(蕩HD$8MGb:HD$HH-HEML=H<$IEt H$HHD$Ht H8MHD$IHt H8D$LHD$ H$H$A A|H-1A uxH\$P1H5yHIoD$PHD$pHH$)$oD$`H$)$0oD$PHD$p$oD$`H$$H|$ It,jIjHT$HHHt$8H|$0L$?AZA[HHKD$LD$8D$HfLd$I MHD$HT$H L L H $H$E1E11HD$HqT$H1L$8HND$HD$ E1H|$L=D$481MMH<$L=HhwH-IH$HkAă7 H AaHcH>DHtLS{HEHL1lnMtLWIEHLE1;nfDMLEIHLD$8E1n^fDH<$LtH$HHtYLD$HmH$H|$Ld9HT$LHHtmHD$LxmD`Wt$4IDž!HyM1ilH$dH+%(H[]A\A]A^A_1111E1E1E1E1f.H6L=&HEMH<$HD$H+H8TfDd$HE\$4f1:f.H|$aLMt6I>&I%f.HaHH5 H81etE1HD[]A\A]A^A_1111E1E1fHH HHDfDAWAVAUIATIUSHH(dL4%(Lt$IHD$FoHHHHD$HD$HI蕲H11AVHT$MMLHHt$ ZYtwH\tIH|$%HD$HuHD$dH+%(uRH(H[]A\A]A^A_1111E1E1ÐHH5H81sHt$H%H1%Cf.AWAVAUATUSH(H4$dH%(HD$1HD$HHD$IIIHD$E1fLLuH1AWLD$MHHT$IZYHl$Mt\1(HLLH+'H!9|H|$*$HD$Mh#fDKDIHuH|$#E1HD$dH+%(u7H(L[]A\A]A^A_1111E1E1L3L37BATH SHH ML"jLDE1jR1jjjjXH@uMtH[A\1111E1E1DH;D$ 4#HD$ H[A\1111E1E1ATIHqSHH HL&HVLDE11j1jjjjjH@uMtH[A\1111E1E1H;H5&HD$ 5fHD$ H[A\1111E1E1@@1AATIUSuQrHH111H.HHtOHIcHM>HuCK1ҾHDHHkI>HLH51qn1|fHAH5H8zJXDH!H52H8ZJ8DAVAUATUSHH?-^AHA1W*AąwDHE;IHAH%HHtE[H]A\A]A^1111E1fDqH߾w[]A\A]A^8Id7L-MHHH5]1I}mI} LA7o@C8H7L%IHHH5 11I<$lI<$%8fH6L-IHHH511I}zlI}qDj@SHt LHH`IHt:H Hr LLD$dHjusH-HH5T1H}cH}~ H|$(HD$(HD$hdH+%(uHD$(Hx[]A\A]A^A_1111E1E1fHXLL$ HL$(KHH|$0 oD$0oD$@CHD$PHC xH\$(w3AUATUHSHHdH%(HD$1H$tHu{4HH:1HHSHD,H5SHHCHH81NbH$HT$dH+%(H[]A\A]1111L-AHH5qSI}bI}E~JDH5gS1a$4Nff.HH5H81a%H51a82UHSHdH%(H\$HH$3tiHH1HHRHDo+H5`HHHH81!aH$HT$dH+%(u2H[]1111fDHٻH5H81`zv1fDSH1Ht[1Ð[HH Ѓ1ÐHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$HHHD$HD$ HD$H$HD$0HHHT$dH+%(uH1111E1E1X0UHSHH HHRHDHu HtHhHHH1[]lff.SHH=i\ HtH[[1UHHSHHtH\ HtH^v'H=[.Ht$HHH[]H H8tH[]11fUHHSHHtH HtH]vOH=HtHHH[]HCHHH[]111@Hp HHtfDSHH=HtH[[1HtH=1H7HH1@HH%H=HHHtH5QHRt1H11f.H=YH5]uH=BH5#uH=+H5OuH=H5=)ff.H=Ht HWFHH1D1ff.fH@AWIAVAAUIATUSHH=|HH1MtIWH5OH1IHE11ɺHOLHsAELAALH߉D$ XADžEL5OHcL%UH$HzHLHAUDL$AHL$ AXZEyE111ҾH H[]111@111ff.AUATUSHHGt8C1E1L H H1[]A\A]1111H?HI2tCtt0H;EDHsH;LHIŋCMucuHsH;HLm;H;HECHQE1H(H;H[]A\A]1111@H;t3ECL1"HsHL:H;HECHtAUATUSHdH%(H$HH5FH'uILc:LHHtb{:txufE11HFLaHB HzN1H$dH+%(H[]A\A]1111E1H?F@HLHL)HHHF, H}ZHINHIMt-Ht(/H޿FEHtL HhM "L&SH5E1HHtH5H"uHrR1[111H5IH1tH5H=tH5SHtH5`HH5tH5]H6tH *¸uwfHH=D|HHQ1f.=1AUAATUHSHL%qA$~71ff.fHA9$~|tHp2A9$?H5nDHADd%@Hm8u1111Y.fAVAUATUSHdL4%(Lt$I011>HH5CHc;H%DI1E~)ff.ff.fADH9H-H#H#D#EuM1Ld$ff.;+1LLcEA 8DEtL1H `CL1 L1 H9tD9u9 D$tXAAqAQ~8H"HBLHDHH P1AYAZ?DE:tm3~7L1ff.DH9t:u; fLAH BL1LH5ALL1!1!DYEuX0HD$dH+%(H[]A\A]A^11111E1E1E1E1@0u> 1y:ĺLAH 18~>1;MH /AI82LIH [1!H nL1L@H wA9ff.fAVHAUI(ATIUSH@H@dH%(HD$81Lt$L\;xL>gH9H F?v ff.@AWALAVILAUIATI1USLHdH,%(H$LHEMAH pH>HHEHa1E18=v@H$dH+%(HD[]A\A]A^A_1111E1E1fDI 6 HFHt$AIH $LE)1] MH >L1E1< LL1H5H~HLHE1$A11Ҿ L\fAUIȉH=ATE1UHSHHdH%(H$1H7=wLH N=1IHE1 HH1H5G H߅A11H$dH+%(uHD[]A\A]1111E13AWAVAUATUSHH $HxH)H|$(ILHt$0HL$ LL$dL,%(L$hL$HHtHHL1L<H ^< $WHD$`HHHD$5Lv<H <1H|$ Htx tH|$ HA H;LHD$Lo<HH1 LD$LHٺ1 $|$`POSTLLL$H }L1y H ;HLr1H3$~1AAHBH )H1Ҿir$A11ҾiHOHT$X1oL|$XMH 1MLH|$X"L9L 11ҾeHH~&H3HHD$ H(H1ff.H$hdH+%(Hx[]A\A]A^A_1111E1E1E1@|$`GET LL$dt*|$`POSTL9N|$d HL$1L$`:HHx HPufH: tH|$;H57HHT$HT$HH56HT$#HD$fD$`L=HL$L1L3HL$L1HLH 6L{[L|$LH 1MHk5LHD$HHÿL 61zM7fLD$H L|$L1H M<H5LHD$HHÿL51M31L1L4H 4H LLMt L3I<$L I$LeHD$ HLILD$H |$d asIL4(14:MLH|$(HD1~ HH2Mt)L2LLLT$A;I$H@HD$0LHHL$LLLLL$8HL$HL$LL$8HIt}LL$@HL$8H.HHt^HD$H|$L HL$8LL$@ILD$MH H U6HLAH L1ILHL$L1LBHLH 2LIIH :LL@1zHt$(H#HLH Lc1LT$$K H52HLHD$1ɉfDDAVAUIATIUSH@L$L$t@)$)$)$)$)$)$)$ )$0dH%(H$1H$p$ HD$H$D$0HD$9-Q %H\$0H=,HLPHHs1!+H1ҾOH_HPHH0HLHH\$H5>H1;;11Ҿ HH)HH$dH+%(H@[]A\A]A^11111E1E1Y&zo$HT$LIHD$LD$HD$(#LH51:L ff.w51111E1HA1HH o01H1111E1f.fH6H? HHH>ff.AWAVAUATIUHHSH`LA5AuU1LL5.16IL&H5'HI1r9LLH1b9A9AuH[]A\A]A^A_1111DHHH5z/1[]A\A]A^A_9fH5V/H18Qf.ATH:/UfHnH9/SfHn1H@~9dL$%(Ld$8IHfl)$~fl)D$~Lfl)D$ Hut*HHtYH}HHuLHuHD$8dH+%(uYHLH5[1HLH@H=[]A\HD$8dH+%(u H@LH5"1[H=]A\P{ff.uwHHcH>HZ.11H11H;.11H-11H-11H-11H-11H-11H-11H-11Hi11H-11H-11H-11Hn-11@H11H 11SHH#ff.ff.8/tHHH9r[11fH[11HH H9tHϺ'H7HHH1111ff.fUH-TSHHt)HHO'HHϽH)H|1%HH[]1111ff.@H@H=1fATUHS1HH5H=%,1[1]A\111tRH5,tBH5 ,Hst/H5+H`tH5HMufA$[]A\111fD@uHH51H=%H5^HH-NL%fDHuHHHcEHtL1f.@@_HH5w1H=H5H1H-ҀL%fHuHHHcEHtL1\f. HH51H=*H5cHH-SL%kf.HuHHHcEHtL1f. @ƀ_HH5w1H=H5H1H-L%fHuHHHcEHtL1\f.H5) H5)H¸H5HH=d1H56HH-&L%>.ff.ff.HuHHGHcEHtL1f.H5eJH53H3H5HH5(HH5(Ht=H5(Ht*H5~(HtH5HmH5HH=1H5}H?H-}L%HuHHHcEHtL1sڐH5HH=1JH5}HH-s}L%f.HuHHHcEHtL1f.@ HH51H=.H5}HQH-|L% fHuHH'HcEHtL1|f.HH51H=JH5|HH-s|L%f.HuHHHcEHtL1f.@HH51H=.H5|HtUH-{L%ff.fHuHHt+HcEHtL1fD fDH=1Z}DHH51H=8H5q{HtH-e{L%})ff.ff.fDHuHHtHcEHtL1fDH5HH='1H5zHHH-zL%HuHH'HcEHtL1|ڸ  H5%HH=1TH5zHH-}zL%%ff.fHuHHHcEHtL1f.ATUHSHZ$~0 wH HcH>H.$fH5YH=1H5yHtKHyL%дff.@HsHHtHcCHtL1HHtDIH@H{HHt+L uCAEH[]A\A]111fH5H=1HuHt)Hff.H1HHuHuH1[]A\A]111fDATIUHSH>Ht:HDH{HHt#LK u[]A\11fH5H=1KHuHHt"ff.H1H"HuHu[1]A\11ff.AUATUHSHdL$%(Ld$I1HHD(HH$:uGH9tBHHHv;"t*I$)Hutff.fH1D+HT$dH+%(uH[]A\A]111mff.fUSHHdH,%(Hl$HH tNH$HcȉEH9u"HD$dH+%(u.H[]1111ÐHH5H=11ff.@HH=dH%(HD$1Ht$D$?D$HT$dH+%(u H111{ff.AUATUHSHdL$%(Ld$I1HHD(HH$:uGH9tBHHHv;"t*I$)Hutff.fHH1D+HT$dH+%(uH[]A\A]111ff.fAUATUHSHdL$%(Ld$I)1HHD(H@H$:uWH9tRHtfDHff.HT$dH+%(]H[]111f.@HS+1 H|ƅxH~@ HfHnfDHVfDH>fDH&fDHfD@HfDHsfD H[fDHCfD H+fDH~fDHffDHNfDH6fD HfDHfDHfDSHH 31HHff 1HHHHH4$HH5H=H11H5H=H1轼1aH5jH=H1虼1H5UH=gzH5=H='bH5%H=0JuDH=@H%@HHcHH1H1H8t HH8uH1DUSHHH(HtF}t@HHHcHLHt9uMH[]1111fDHtHH5 H=1>1H[]1111DHH5޹H=w11@Ht.HH5H=pH1޺1f.HH5H=#躺1wAWAVAUATUSHL7dH%(H\$xHM&L-ILff.L9t+&A D`-tH EdD9ALIIHuø9OH'HD$I9 L-E1fnfpff.L{1M9A HFMLDHD$I9L;5M9HD$ L;5kD$pHD$Hc)D$ )D$0)D$@)D$P)D$`EHH5HEL51LAH3H="¸NЀ>HHD1T${ T$ƒ-t$T$LH1T$¸9N9)HD Ht$L1H=v襸foLsHMHD$xdH+%(HĈ[]A\A]A^A_1111fDL% 1H=L;L3L;5tLH=1L3MtH$HD$D-H5vH= 1߷foD$p )D$ )D$0)D$@)D$P)D$`fH=21袷H5[L1葷fo@H=71rfozHdH4%(H$H¸uD$%=@H$dH+%(uHĨ111'AWAVAUATUSHHH-dH%(HD$81HcصHŵH HHDHL$Ht8-t61HT$8dH+%(HH[]A\A]A^A_1111E1fDSx-kuxtff.x-L`=LH+HHPHL5M.ME<$AhuE|$EuH5LtLLutAF H tM-tHH?PуFw@H HcH>fDHPLI?HuYHAFfDMnIMTH HH H<L%@tF AFHEH=HT$pIHͳH5vH=誴 H=Ht$_tAF pFND$IHoH51H=WJLH5H=ߵ1(yH=,HH5H= 1DfDH=Ht$(x f.H=ɲHt$ PfH=Ht$0fH=Ht$0fH|$HL=HH SUT$IH2H5۱1H= ^c&HE  H̱MH51H=!輲 LH5mH=z 1蟲LH5PH= 1育f.f.f.f.f.f.~2?t@HW u(1fD:t%Httl@H 1fDHJ1fDH +u1fDH@u1fDH1fDH51fDH1ff.AWAVAUATUSHHH|$!HCIH[HHuD$H}lL-k L%N IO8IW0Iw(H|$D$Dt$0H;H5^D1JII(I H;L1H艫H;H5JH_HIHt2H A#FH;IEL1IIHuH;H5 1H|$11ҾcH;H5a HdHEu2MPMH[]A\A]A^A_1111fIw(H|$tH5<uH\HH\)ff.ff.fDHXHHtD;xuAA cA tUAtOA <HcHHc@HPHHD;`uI>H51HD^I>H`HEH51cHD$dH+%(H([]A\A]A^A_1111E1E1D=?H6I>HH51fE1 A}ALHH9HHHD$\111ILD$1HI>HT$H51 fEefAEHI>HH51U H]HH]ff.HPHHD9`uI>H51 I>T$ H5W1 ^fDHtI>HH51 L?I>HH @H \AUAuHt$Hk\fHHHHt;PuH[HH[&ff.f.HPHH_;puHQI>H5;1 D=#f.Df1=t==EefAEI>DH5ͭ1 HH51fE1p At+ATL,I>HqPAA IA oAeA Df1=t =qI>DH51 DHoI>H51 AtEefAEff.H=Ht0HHH5E1+ H=ܨ11Ҿ HfHdH5ZH81 SH5kHXFHxHHHHH@P1H)XHHHBHHHBHHt HJHPP[11111B[11111AWAVAUATIUHHSHHdL4%(Lt$8A#EHE1E11j11LAYAZAŅ H5H H5H EHD$/Ld$1L=EH$HD$0HD$HD$4HD$HD$.Iff.fEHE1ATLL$HL$HT$ H|$(sY^tH5sH~D$.T$/ - w IcL>|$4OHHHH5d1|$0fDD9THD$8dH+%(HHHH5[]A\A]A^A_H5HH5HH5lH|@H5AHd@H5HqL@H5HY4@HE1LE1j11Ҿc_AXAŅHD$8dH+%(HH[]A\A]A^A_11111E1E1E1HE1ATLL$HL$HT$ H|$(XZ,DT$/HH51r|$0t:eH5HH1Q\@H5HiL@T$.H5rH1%AWAVAUATUHSHHHIHAkAHASDHEt(t$A+HDHcH>fDL=`1DH5I?M'>LHD$:I?HL$1H踟I?H5GyuIcI?DH5H1&HRD9}HyR1D@ D`EA+HpEJcH>EG>H/RP$H[]A\A]A^A_1111E1E1DI?H53Mt5I?H51fLI?HsI?H5B1B1MtI?H5i1 LxMtI?H52@MtL=]MwL=]M_L=]M[1M1H$PpoH1_^M1f.HtWATIUHպSH~LHLHDH蕛~iL[]A\111Ð111@H-\HH51H}H}1[]A\111fDH\HH5w1H;H;赩1ȐH\H5zH811@HCAUIATIUDSHHxLH~YHMtLXHHuZH[]A\A]1111E1H[H51H;H;ب1H[]A\A]1111E11MiH1HqHuH}[H5ƣH;H;~1f.HQ[H51H;XH;P1sf1111E1H [H5H8113fHZH5H;H;1ff.AWAVAUATIHUSH8dH,%(Hl$(HLl$ 1HH\$L#HL1HپlH豩Ht |$1L龍H莩HtIHT$ H5CL1#HD$(dH+%(H8[]A\A]A^A_1111HHt|$H5LH1fL1ҾgHHÅH5pLCHTHD$HD$ D8HE1HSHXHHD9xuMtH5cLUHLLGLsH9\$tMHD$ D|HSHuDH5LLDH5L1LsH9\$uH5|LH5LH1:f.Mt1AW1AVAUATUHSHdH<%(H|$HHo苧H5HA1OL=GL5ZL-m;H5pHH$A9t8H5HH$tauLHH$A9uH5{HHD$dH+%(uGH[]A\A]A^A_1111fLHgLH1CUfAW1AVAUATUHZSHHHT$ 1SBHcH5`IE1HEt$L%681ҾZHHIH59HIMtH5HCtH|LHH1|IGM9uúH5L_D$ H5Ht1ɾ]HH~DpE1L=5 fDIMt LH-1L]H;HLHH1IEM9uH5yHH[]A\A]A^A_1111uH5kfHf.U1HSHxdH%(H\$hHHmH蠤HtcH5HlH<$cH<$yH5H1H<$ݰH=HD$hdH+%(HHx[]1111E1f.=H\$LD$PHH5m7H<$HH5ZH1PUSH5OHHHHHD1!&@H5H1cH<$H5HH1fD11H߾H߉H5THH1@?fD$ @AWAAVAUIATIUSHH}Lct$@HHAgAAuXD|$@EH|$HHD$HHMHLH5țLAQH1HD$XHHOAZA[HL[]A\A]A^A_1111E1E1E1E1DAűt$@HC H8tE1ff.LkHLHH531ML+IMEIMAPM,AUIuH謢HC ZYL;8rQ@D$@H|$HHD$HHMHLH5gLAQDDL$@EHC E1H8fLkHLHH51ML+IMEIMAPMlIuAUHHC _AXL;8rDL$@MHLH5KH1)i@DL$@MHLH5˙H1A@H{2HDL$@HL@@H{HDL$@HL@ff.ATUH-Su H-HHE@uy@tQHL%LE蕞H[[ILHH"P]H5oA\H81&fDttGxe[]A\11111E1HH5<HHOH8[1]A\f˨HH5HHOH8f諨HH5HHOH8fAWHAVL5AUIATULSHdL$%(L$L$LEuH,IHcHI+ff.ff.@HXHH/;pu1/6=HrLQH~)HrL%HtbLOtSѾHT1HHSrIH,AЉHH1HH %rHIPLILQH5H1 _AXH11Ҿ LܖH$dH+%(WHĘ[]A\A]A^A_11111E1E1H&HqLGHef.HeHDAMHHCfHPHHe;HuH -qL QRILHH5 L1XZH5*L11L5L=ff.fuHt LL1ATLL1HH9rH5pL1H LIHupHLAEH<t <HHEH =DAuHH(DfDHHHHtc;puLHpHE1LPHwH5LPL1Y^H oHILH 5LyHoHPLugHLKPSfATIHUH DSL*ff.ff.HHHHtS;xuHKAAHJHH5~HE1LHvH1[1] A\H AWAVAUATUHSHHbdL$%(Ld$IH$u#H=IL"HʶH+E1L01HL0H<$LH5AH$HxH<$+1LfD8HHp]ATL 1hE1H R1UH5 t$SjHH0HHߺH5.藧LώHD$dH+%(H[]A\A]A^A_1111E1E1@3IHHML1Ҿ.HDHIH51H81rHHH581H81LJfHHH51H81HHH51H81,uH5H=@ATUSH`dH%(HD$X1u*1HT$XdH+%(uSH`[]A\111fLd$HHLHT$HtHT$H9uHL蟙耽SHdH%(H\$HHH$tH$HT$dH+%(u H[111+ff.DHH5ff.fHt_UH-SHHH{(H{0H{8%HH[HHGHuH[]111111ÐUSHHHHH{HuhfsL cE111rHC0HH{ Ht1HS8L?1yH[HHtOH{Htm3L1ɺamHC(HtgH{H{3H{sHHEH[]1111E1E1fDH{HtHEH5sH81H1[]1111E1E1f.ATUSHHdH,%(Hl$HH$HIHSHcH>H$H{1|L%-EH5H1I<$0I<$'HHE1HT$dH+%(H[]A\111fH$H{t HH$H]HCDH$HXHھHfH$@@fH$fH$H{ tU萳L%ADH5BH1I<$DH@H$HE;HCFf+HC 6蝹ff.fAWAVAUATUSHHHdH,%(Hl$8HHD$ LHuH?H5HI1MtLH5H11HT$ HSy_HD$8dH+%(`HH[]A\A]A^A_11111E1E1@HH5HH1f.HL$HT$HHD$(Ht$LL$0HD$0LD$(͓HL$0Lt$(AH H5;Mt$H5:IHHHff.@AIHBAFBH9uAEH|$0 L KfvL L$T$H1AUDD$/H5H!HɖZYHH5?H1H5Lu@L< HL$IH9H5?#HL$IHLHH51ff.DAIHBAFBL9uMAH|$ H_t!DH5H1-+EH#H;HEfI薶!HL$H5HH@H81GAWAVAUATUSH8dH%(H\$(HxIH=HHD$H-a@H5IH1H}dHLHLH$H}H5VH1/H}1HH}M H5;8LIȲH}1LHGH}H5c1HL$H߾lH 1HL$ HHHuHH}HHmH}HHD$(dH+%(H8[]A\A]A^A_11111@11ҾnHwH1ҾnHL$ HYH}H5I&MHt$ E12L踲H}HHD$ IHpHt$ M9HYIMtH}H5MuHD$ H}f8uH5›蠿fDH5N茿HD$ H}H51BHD$ H}H5P1'VfH}H5b@H|$txH5]13DH}H]fH}HT$ H51@|$觱H}H5H1DH5謾H5H=Lf.AVIAUIHATUS1t2fLƼsLI踼LLHHW~3L蘑9L謴¸ta[]A\A]A^1111HH<LH:HDH591H;HH;蜉1[]A\A]A^1111fHa<H5H;蚽H;b1ff.AUAATUHS1HIHûLHXH谐9|EuH[]A\A]111ÐLHCH[]A\A]111fAWHAVMAUMATUSHHH H<$Ld$XHt}HHHH_W1LHHL9|H<$HjHD$`!HLL 2H|$PQHHmHt$PHH<$Hk蚥HfHT$IHHHT$HtHHzt&MtLHtH@H11H߉$~Hv$H[]A\A]A^A_1111E1E1fDH1f1HXA111+HHtKMt.LHbMuH|$PDLH5u3@1(H]9SH5}HH} HH5H|薾HH5|[fDUHSHHH=|脈H|HtDHt?HH5rH|HHti11ҾÁt'H5xH1H[]1111H=Y|H5JŹH=F|11Ҿ pfDHY8HH5H81]fDAVAUATIHUSH&H)7H߅H8HDI跖HtHH觌u#H[]A\A]A^11111LH5L11L-[6kHIKL1LHvLL苬H#9[]A\A]A^11111@[L]LH5AA\1A]A^Lff.UHHSHH蘣uH<=E1H1ɾLTHZHH5+HHHDH1[]HHH5"1[]fUSHdH,%(Hl$H1HH#?w HHxT$Ht$HV11Ҿ H5HD$dH+%(uH[]1111輫f.fAWAVEAUIATUHSHHXH$HL$LD$HD$dH%(HD$H1HD$8HD$@dt?E1HD$HdH+%( HXD[]A\A]A^A_1111E1E1E1E1fHAHDHD$@1HPD$D$ӐA[[HD$H D$Hl$8HlD$ 1D$$E_D$E$oL|$@MLHH>9L辏IHu1H謏HHu@A}H|$@qD$$eH|$H-}HD$HHXH|$8HHDHD$踄Hg t.H|$8袄HKtH|$8茄HAHELL$HL$I1H3H5H;tHD$$KHHD$(%t$(1ɉډ薊AELqA}H{H$t/HdqA}T$ H4$H|$!H)qH聐HL$Hd@HqHHHt/H2HH5+H81H5H褐?H|$@HtH|$8T$ $0D‰D$ HD1HD$HPD$D$Ht$ H|$躍AYAZH1H8DH1H;~E1RHxHD$,,HD$(PT$,t$(1ɉ迈AEHAIHD9pH5H=\}H;$|fH蘐;$MfH1H8!~m@A}L,|AE[LLH0H5;H81A}{AEHTHD$HTD$$A}{AE&fDATAUHSHdH%(H\$HHtHHtH H$HHtHD1H$HDžu*UuHD$dH+%(uGH[]A\1111@HtHEH$HHtǐH<$HYfAWAVAH5)AUAATAU1SHH(dH%(HD$1t~AAEEu\H5NSH11I H߅@11D!xHD$dH+%(H([]A\A]A^A_1111f苸H5H߉1A!|HT$Ht$D>Hl$HLl$Mtv:H|LHHHH5HHD1E1qAH|$H-HRH|$ H@E2fH5H1E1赣DAWEAVAUATIUHSDH8H$pHt$L$ HD$H$xH$H$HD$ dH%(H$(1HD$HOtBE1H$(dH+%(9H8D[]A\A]A^A_1111E1E1DHAAEHD$PHPL$H|$ 迈_AX"t$ XEtH|$H葾D9H|$Hn}H|$HA1H|$HeH|$HD$8jH|$HHD$(ȇ$HDžt !DDDA DDHtH|$0ыH|$09T$8D1ɉdAAiHt$(DDGH|$H襨H,H8&yD>wL-oE1|$ @I}@qIE\H|$H99CH5H=x9fH|$H6|T$ 9H|$(H|$H1H|$ fHD$HD1MtE4$Ll$$fEu"E1tAH $DDAՅyL-nAD'vH*H8wTH|$HTH*H8wL-nH|$}ET$8H|$090AA  {DDDDuHI*H8YwL-2n6D|$mock server received error: pkiStatusInfo absent pkiStatusInfo: %s errorCode absent errorCode: %ld errorDetails absent errorDetails: %s: Use -help for summary. Unknown item name %s Supported types: %s Error reading PEM file asn1Can't find 'asn1' in '%s' '%s' is out of range Error parsing structure Can't parse %s type Error: offset out of range Error writing output Error parsing item %s ../apps/asn1parse.cGeneral options: Display this summaryoidfile of extra oid definitionsI/O options: informnooutdo not produce any outputoffsetoffset into filelength of section in filestrparsegenstrgenconfstrictpemitemitem to parse and print(-inform will be ignored)Formatting options: indents the outputunknown data in hex formdlimitCAkeyTimeholdInstruction../apps/ca.cMemory allocation failure row exp_datarow ptrfailed to update database TXT_DB error number %ld ERROR:name does not match %s Revoking Certificate %s. Unknown CRL reason %s Invalid object identifier %s revocation reasonExpiredRevokedValidundefPRINTABLE:'T61STRING:'IA5STRING:'UNIVERSALSTRING:'ASN.1 %2d:'\0x%02X^%coptionalsuppliedmatchType :%s Was revoked on:%s Expires on :%s Serial Number :%s File name :%s Subject Name :%s Certificate Details: (%ld days)Sign the certificate? [y/n]:row expdaterow spacecertificate requestError unpacking public key Signature ok %s=Expired memory allocation failure invalid revocation date %s invalid reason code %s missing hold instruction invalid object identifier %s missing compromised time invalid compromised time %s default_caoid_filestring_maskutf8yesunique_subjectdatabaserow serial#Serial %s not present in db. %s=Valid (%c) %s=Revoked (%c) %s=Expired (%c) %s=Suspended (%c) %s=Unknown (%c). Error verifying serial %s! private_keyError getting password CA certificatepreservemsie_hackname_optInvalid name options: "%s" cert_optcopy_extensionsnew_certs_dir%s: %s is not a directory in entry %d generating index Updating %s ... Malloc failure UNDEFdefault_mdno default digest email_in_dnnomessage digest is %s policy is %s rand_serialx509_extensionsdefault_startdatedefault_enddatedefault_daysnext serial number is 00 next serial number is %s error on line %ld of %s template certificateerror unpacking public key CERTIFICATION CANCELED writing new certificates writing %s Database updated crl_extensionscrlnumberdefault_crl_daysdefault_crl_hoursmaking CRL error setting CRL lastUpdate error setting CRL nextUpdate signing CRL no input files certificate to be revokedunspecifiedkeyCompromiseCACompromiseaffiliationChangedsupersededcessationOfOperationcertificateHoldremoveFromCRLoutdirWhere to put output certThe input cert request(s)infilesdateoptnotextbatchDon't ask questionsss_certspkacConfiguration options: A config fileAn alias for -nameThe CA 'policy' to supportCertificate options: subjcreate_serialmultivalue-rdnnot_beforeAn alias for -startdatenot_afterAn alias for -enddateextfilepreserveDNDon't re-order the DNnoemailDNDigest to use, such as sha256The CA private keyThe CA certselfsignvfyoptRevocation options: gencrlGenerate a new CRLupdatedbUpdates db for expired certcrlextscrl_reasoncrl_holdcrl_compromisecrl_CA_compromisecrl_lastupdatecrl_nextupdatecrldayscrlhourscrlsecRevoke a cert (given in file)Random state options: writerandProvider options: provider-pathproviderprovparampropquerycertreqUNKNOWNOpenSSL cipher name: %s Error in cipher list 0x%02X,0x%02X - %-45s - Usage: %s [options] [cipher] Even more verbosestdnameShow standard cipher namesconvertOnly supported ciphersCiphers compatible with TLS1pskciphersuites../apps/cmp.c%s:%s:%d:CMP %s: %s %s%s actually sendingactually using%s:%s:%d:CMP %s: No %s%s%s Key %s: Key algorithm: Key algorithm: RSA %d Invalid key spec: %s End of key %s%s:%s:%d:CMP %s: %.*s%s deletingwriting%s certificateverbosity-%strusted TLS certsextra certificates for TLSTLS client private keyPBMACextra certificates for CMPcertificate to be updatedhttp%s://%s:%s/%s via %skurp10crgenmuntrusted certificatescerts trusted by clientPKCS#10 CSRSubject Alternative Namerecipientexpected senderint:str:PBMAC secret of mock servercerts trusted by mock servercaPubs for mock server from pkix/Not FoundInternal Server Errorapplication/pkixcmpNewWithNew cert from genpNewWithOld cert from genpOldWithNew cert from genpCRL from genp of type 'crls'certTemplate from genpkeySpec from genpwbPKIStatusInfo bufvalidated servernewly enrolled cert and chainnewly enrolledAES-256-CBCGeneric message options: cmdinfotypeprofilegeninfotemplatekeyspecnewkeynewkeypasscentralkeygennewkeyoutreqextssanssan_nodefaultpoliciespolicy_oidspolicy_oids_criticalpopocsrout_trustedimplicit_confirmdisable_confirmchainoutoldcertrevreasonMessage transfer options: no_proxykeep_alivemsg_timeouttotal_timeoutunless -srvcert is givensrvcertexpect_senderignore_keyusageunprotected_errorsno_cache_extracertssrvcertoutextracertsoutcacertsoutoldwitholdcrlcertoldcrlcrloutown_trustedunprotected_requestsCredentials format options: crlformotherpassTLS connection options: tls_usedtls_certtls_keytls_keypasstls_extratls_trustedtls_hostrepeatreqinreqin_new_tidreqoutreqout_onlyrspinrspoutuse_mock_srvMock server options: max_msgssrv_refsrv_secretsrv_certCertificate of the serversrv_keysrv_keypasssrv_trustedsrv_untrustedref_certrsp_certrsp_keyrsp_keypassrsp_crlrsp_extracertsrsp_capubsrsp_newwithnewrsp_newwitholdrsp_oldwithnewpoll_countcheck_aftergrant_implicitconfpkistatusfailurebitsstatusstringsend_errorsend_unprotectedsend_unprot_erraccept_unprotectedaccept_unprot_erraccept_raverifiedValidation options: certificate chain purposeverify_nameverification policy nameverify_depthchain depth limitauth_levelattimeverification epoch timeverify_hostnameexpected peer hostnameverify_emailexpected peer emailverify_ipexpected peer IP addressignore_criticalissuer_checks(deprecated)crl_checkcrl_check_allcheck full chain revocationpolicy_checkperform rfc5280 policy checksexplicit_policyinhibit_anyinhibit_mapx509_strictextended_crlenable extended CRL featuresuse_deltasuse delta CRLspolicy_printcheck_ss_sigcheck root CA self-signaturestrusted_firstsuiteB_128_onlySuite B 128-bit-only modesuiteB_128suiteB_192Suite B 192-bit-only modepartial_chainno_alt_chainsno_check_timeallow_proxy_certsBad input format for %s rbCAdESCMSInvalid key %s Invalid id %s Invalid OID %s recipient certificate fileNo key specified key param buffer../apps/cms.cNo secret key id originator certificate fileSMIMECan't read content file %s Error writing certs to %s Can't open receipt file %s signer certificateError creating CMS structure %s Verification successful %s Verification failure Error writing signers to %s Signer %d: No Receipt Request Signed Content ID: Receipts From List: : First Tier : All Unknown (%d) Receipts To: To: %s%sFrom: %s%sSubject: %s%sInput fileOutput fileOperation options: Encrypt messageDecrypt encrypted messageSign messageVerify signed messageresignResign a signed messagesign_receiptverify_receiptdigest_createdigest_verifyuncompressEncryptedData_encryptEncryptedData_decryptdata_createCreate a CMS "Data" objectdata_outcmsoutOutput CMS structureFile format options: outformrctformReceipt file formatEnable CMS streamingSame as -streamnoindefDisable CMS streamingbinarycrlfeolasciicrlfKeys and passwords options: pwri_passwordsecretkeysecretkeyidinkeyInput file pass phrase sourceoriginatorOriginator certificate filerecipRecipient cert filecert...aes128-wrapUse AES128 to wrap keyaes192-wrapUse AES192 to wrap keyaes256-wrapUse AES256 to wrap keydes3-wrapUse 3DES-EDE to wrap keydebug_decryptDigest algorithm to useSigner certificate input filecertfilecadesnodetachUse opaque signingnocertsnoattrnosmimecapno_signing_timereceipt_request_allreceipt_request_firstreceipt_request_fromreceipt_request_toVerification options: no_content_verifyno_attr_verifynosigsnoverifynointernverify_retcodeTrusted certificates fileno-CAfileno-CApathno-CAstoreUse subject key identifierecontent_typeOID for external contentCertificate output fileTo addressFrom addressSubjectPrinting options: nameoptreceipt_request_printPrint CMS Receipt RequestMissing CRL signing key other CRLCRL signing keyError creating delta CRL issuer=crlNumber=0xissuer name hash=%08lx issuer name old hash=lastUpdate=nextUpdate=NONE%s Fingerprint=%02X%cunable to write CRL Verify CRL signatureInput options: Input file - default stdinoutput file - default stdoutOutput format - default PEMPrint hash valueAny supported digestCRL options: Print issuer DNSet lastUpdate fieldSet nextUpdate fieldNo CRL outputPrint the crl fingerprintPrint CRL numberbadsiggendeltaunable to load CRL error opening the file, %s error reading the file, %s error loading certificates unable to write pkcs7 object Input format - DER or PEMnocrlOutput format - DER or PEMRSA-%-25s\ *%s ../apps/dgst.c%s(%s)= Read error in %s Verified OK Error verifying data Signature bufferError signing data Digest bufferError Digesting Data etaonrishdlcupfmI/O bufferSupported digests: MAC parameter error "%s" Error getting context Error setting context Error setting digest signature bufferList digestsengine_implPrint as hex dumpPrint in binary formxoflenPrint debug infoSign digest using private keyprverifyFile with signature to verifyhmacCreate hashed MAC with keymacoptfips-fingerprintDHXsafe Check the DH parametersdsaparamInput format, DER or PEMOutput format, DER or PEMVerbose outputTerse outputnumbitsMSBLOBtype-specificSubjectPublicKeyInfoError getting passwords unable to load Key Not a DSA key Public Key=writing DSA key %s format not supported encrypt-levelinvalid PVK encryption level unable to write key ../apps/dsa.cread DSA key Any supported cipherpvk-strongpvk-weakpvk-noneDon't enforce PVK encodingInput keypubinOutput format, DER PEM PVKDon't print key outPrint the key in textPrint the DSA public valuepuboutpassoutThis could take some time DSA parametersPrint as textNo outputgenkeyGenerate a DSA keynumqbitspoint-formatinclude-publicunable to print EC key unable to check EC key EC Key Invalid! EC Key valid. writing EC key unable to write EC key ../apps/ec.cread EC key check key consistencyPrint the keyparam_outno_publicnamed_curveuncompressedhybridprime192v1prime256v1list curves../apps/ecparam.c %-10s: secp192r1secp256r1groupsm2unable to generate key EC parametersECSM2 parametersunable to clear seed unable to print params group-checkunable to set check_type list_curvesGenerate ec keyInput file - default stdinOutput file - default stdoutDo not print the ec parameterParameter options: Validate the ec parameterscheck_namedno_seednon-hex digit base64zlibzstdSupported ciphers: %s Can't read key from %s %s: zero length password %s: out of memory bufsize=%d strbufevp bufferUnstreamable cipher mode encryptiondecryptionenter %s %s password:bad password read invalid hex salt value RAND_bytes failed error writing output file error reading input file bad magic number PKCS5_PBKDF2_HMAC failed EVP_BytesToKey failed invalid hex iv value iv undefined invalid hex key value Error setting cipher %s salt=key=iv =bad encrypt bad decrypt bytes read : %8ju bytes written: %8ju ../apps/enc.cList ciphersAlias for -listEncryptDecryptPrint the iv/keyPrint the iv/key and exitPassphrasekfileRead passphrase from filePassphrase sourceSame as option -anopadUse salt in the KDF (default)nosaltDo not use salt in the KDFbufsizeBuffer sizeRaw key, in hexSalt, in hexIV in hexDefault: 10000Don't encryptDefault: 16skeyoptskeymgmtengine buffer../apps/engine.cSTORE(%s)[Success]: %s [Failure]: %s Loaded: (%s) %s RAND [%s] [ available ] [ unavailable ] description buffer%s%s(input flags): [Internal] STRINGNUMERIC|NO_INPUT <0x%04X>prepostvvvvttID of engine(s) to load%lxerrnumError number(s) to decodest-phasest-descst-typeStart%s : (%s) : PassFailCorrupt%s = %s ../apps/fipsinstall.cactivate = 1 install-versionconditional-errorssecurity-checkshmac-key-checkkmac-key-checktls1-prf-ems-checkno-short-macdrbg-no-trunc-mdsignature-digest-checktls13-kdf-digest-checktls1-prf-digest-checksshkdf-digest-checksskdf-digest-checkx963kdf-digest-checkdsa-sign-disabledtdes-encrypt-disabledrsa-pkcs15-pad-disabledrsa-pss-saltlen-checkrsa-sign-x931-pad-disabledkbkdf-key-checktls13-kdf-key-checktls1-prf-key-checksshkdf-key-checksskdf-key-checkx963kdf-key-checkx942kdf-key-checkpbkdf2-lower-bound-checkecdh-cofactor-checkmodule-macinstall-macINSTALL_SELF_TEST_KATS_RUNinstall-statusfipsfips_sectVERIFYINSTALLno_conditional_errorsno_security_checksno_pbkdf2_lower_bound_checkhexkey:digest:self_test_oninstallnot availableFIPS provider is %s digest:SHA256Failed to open module file Unable to get MAC of type %s MAC parameter error Unable to create memory BIO version not found Module integrity mismatch install status not found VERIFY PASSED openssl_conf = openssl_init [openssl_init] [provider_section] %s = %s Failed to load FIPS module buildinfoname: %-10s %s version:build:3.0.Failed to open file INSTALL PASSED %s FAILED pedanticmoduleprovider_nameFIPS provider namesection_nameself_test_onloadems_checkno_short_macDisallow short MAC outputno_drbg_truncated_digestssignature_digest_checkhmac_key_checkEnable key check for HMACkmac_key_checkEnable key check for KMACEnable digest check for HKDFtls13_kdf_digest_checktls1_prf_digest_checksshkdf_digest_checksskdf_digest_checkEnable digest check for SSKDFx963kdf_digest_checkdsa_sign_disabledDisallow DSA signingtdes_encrypt_disabledrsa_pkcs15_padding_disabledrsa_pss_saltlen_checkrsa_sign_x931_disabledEnable key check for HKDFkbkdf_key_checkEnable key check for KBKDFtls13_kdf_key_checktls1_prf_key_checkEnable key check for TLS1-PRFsshkdf_key_checkEnable key check for SSHKDFsskdf_key_checkEnable key check for SSKDFx963kdf_key_checkEnable key check for X963KDFx942kdf_key_checkEnable key check for X942KDFecdh_cofactor_checkmac_namecorrupt_desccorrupt_typeCorrupt a self test by typeThe parent config to verifyNo messages, just exit statusparams file../apps/gendsa.cdsaparam-fileAlgorithm already set! floatuint %s%s:%s Can't open parameter file %s Error initializing context Bad format specified for key Error writing key(s) Error printing key ../apps/genpkey.cparamfileParameters fileThe public key algorithmpkeyoptOutput (private key) fileoutpubkeyOutput public key fileoutput format (DER or PEM)genparamGenerate parameters, not keyPrint the private key in text../apps/genrsa.cError setting RSA length Error cannot access RSA e e is %s (0x%s) Usage: %s [options] numbits F4f4Specify number of primestraditionalSize of key in bitsUndefined%s: Only one item allowed %s: No items chosen configdirenginesdirmodulesdirdsoextdirnamesepDirectory-filename separatorlistsepList separator characterseedsSeed sourcescpusettingswindowscontextWindows install contextalgorithm name../apps/kdf.cInvalid KDF name %s KDF parameter error Invalid derived key length. out bufferEVP_KDF_derive failed Usage: %s [options] kdf_name kdfoptCipherDigestkeylenkdf_nameName of the KDF algorithmuninitialisedready %s @ %s state = %s stateERROR: Memory allocation %sLegacy: %sProvided: description: %s settable operation parametersProvided KDFs and PDFs: Provided MACs: Provided ENCODERs: @ %s (%s) Provided DECODERs: Name: Type: Provider Algorithm IDs: TLS-SIGALGtls-sigalg-iana-nameProvided STORE LOADERs: %s => %s %-*sExternalBuiltin(none)- - %s %c Digests: Symmetric Ciphers: Provided Key Exchange: Provided Signatures: Provided Key encapsulation: Provided Key managers: primaryprivate../apps/list.c%s%c Key Managers: Name: %s Alias for: %s Type: %s Algorithm OID: %s PEM string: %s Encryption: Providers: name: %s version: %s status: %sactive build info: %s gettable provider parametersEngines: Disabled algorithms: IDEA MD2 MDC2 RC5 SCTP SSL3 BROTLI # None-OID object: %s, %s %s = %s, %s List in one columnVerbose listingselectSelect a single algorithmList of standard commandsstandard-commandsall-algorithmsList of all algorithmsdigest-commandsdigest-algorithmskdf-algorithmsrandom-instancesrandom-generatorsmac-algorithmscipher-commandsencodersList of encoding methodsdecodersList of decoding methodsList of key managersskey-managerskey-exchange-algorithmskem-algorithmsList of signature algorithmstls-signature-algorithmsasymcipher-algorithmspublic-key-algorithmsList of public key algorithmspublic-key-methodsList of public key methodsstore-loadersList of store loadersall-tls-groupsprovidersList of provider informationList of loaded enginesList of disabled featuresobjects../apps/mac.cInvalid MAC name %s EVP_MAC_Init failed Read Error in '%s' EVP_MAC_update failed EVP_MAC_final failed output len is too large Usage: %s [options] mac_name MAC algorithmtoseqOutput NS Sequence fileError creating SSL context. application/ocsp-responseapplication/ocsp-request../apps/ocsp.cissuer certificateError Creating OCSP request Error reading OCSP request responder certificateresponder other certificatesresponder private keyindex file changed, reloadingsigner private keysigner certificatesError signing OCSP request assertion failed: bnassertion failed: itmpError reading OCSP response Responder Error: %s (%d) validator certificatesError parsing response Nonce Verify error Response Verify Failure Response verify OK ERROR: No Status found. This Update: Next Update: Reason: %s Revocation Time: ignore_errResponder options: resp_no_certsnminnrequestsign_otherindexCertificate status index filendaysrsignerrotherrmdrsigoptkey=value header to addrcidClient options: Responder URLPort to run responder onPath to use in OCSP requestOutput filenameDon't verify response at allAdd OCSP nonce to requestno_nonceno_signature_verifyresp_key_idno_cert_verifyreq_textPrint text form of requestresp_textPrint text form of responseno_chainDon't chain verify responseno_cert_checksno_explicittrust_otherno_internrespinVAfileValidator certificates fileverify_othervalidity_periodsignkeyrespoutIssuer certificatestatus_ageMaximum status age in secondsThe command %s is deprecated. Use '%s' instead.apps_startupprog_initOPENSSL_TEST_LIBCTX--help--h--version--v../apps/openssl.cUsage: %s %s: Standard commandscommand../apps/passwd.capr1salt bufferrounds=%u%s %s Password: Read passwords from fileRead passwords from stdinNo warningsFormat output as tablereverseSwitch table columnsCryptographic options: Use provided saltMD5-based password algorithmaixmd5, , %s, %s, Iteration %ld, PRF %s, Iteration %ld../apps/pkcs12.c%.*s %02X %s (%s) %s: %s: Key bag Bag AttributesKey AttributesShrouded Keybag: Certificate bag Secret bag Bag Type: Bag Value: Safe Contents bag PKCS7 Data PKCS7 Encrypted data: private key from -inkey fileprivate key from -in filenomacverclcertscacertspasscertscanameCSPLMKkeyexkeysigkeypbecertpbe and -descertmacalgiter and -noiternomaciternomacmacsaltlenlegacyCan't read Password certificates from -in fileError getting chain: %s Enter Export Password:Error creating PBMAC1 Enter Import Password:MAC: using PBKDF2, Iteration %ld PBKDF2 PRF: %s Warning: MAC is absent! PKCS12KDFEnter MAC Password:twopassnokeysDon't output private keysDon't output certificatesDon't verify integrity MACOnly output CA certificatesnoencDon't encrypt private keysnodesCreate PKCS12 filePEM-format file of CA'sPEM-format directory of CA'sURI to store of CA'sUse name as friendly nameMicrosoft CSP namecertpbepbmac1_pbkdf2pbmac1_pbkdf2_mdDon't use MAC iteration)Specify the salt len for MACDon't generate MACjdktrustunable to load PKCS7 object Don't output encoded dataprint_certs%s: Unknown PBE algorithm %s %s: Unknown PRF algorithm %s Error converting key Error setting PBE algorithm Enter Encryption Password:Error encrypting key Error reading key Enter Password:Error decrypting key ../apps/pkcs8.cUse PKCS#5 v1.5 and cipherv2Use PKCS#5 v2.0 and cipherv2prfInput format (DER or PEM)nocryptOutput format (DER or PEM)topk8Output PKCS8 fileSpecify the iteration countUse 1 as iteration countScrypt options: scryptUse scrypt algorithmscrypt_NSet scrypt N parameterscrypt_rSet scrypt r parameterscrypt_pSet scrypt p parameterPublic KeyKey is valid Key is invalid ../apps/pkey.cCheck key consistencypubcheckCheck public key consistencyKey input pass phrase sourcetext_pubec_conv_formec_param_encError reading parameters Parameters are valid Parameters are invalid Check key param consistencyPrint parameters as text(unknown key type)%s: Error loading key ../apps/pkeyutl.cError: out of memory peer keyError reading peer key %s Enter %s: user abort entry failed failed to get '%s' Can't open signature file %s Error reading signature data Error reading input Data oneshot sign/verify bufferError reading raw input data buffer outputError signing raw input data secret outputPublic Key operation error Key derivation failed Verify with public keyderivedecapDecapsulate shared secretencapEncapsulate shared secretInput key is a public keypeerkeypeerformcertinsigfileasn1parsehexdumpHex dump outputverifyrecoverrawinpkeyopt_passinkdfUse KDF algorithmkdflenKDF algorithm output lengthkemopisis notMissing number (s) to check Specify the number of bits. Out of memory. Failed to generate prime. ../apps/prime.cFailed to process value (%s) Error checking prime (%s) %s prime Size of number in bitsNumber of checksHex outputGenerate a primesafecmscrl2pkcs7dgstdhparamecparamerrstrfipsinstallgendsagenpkeygenrsanseqocsppasswdpkcs12pkcs8pkeyparampkeyutlrehashrsautls_clients_servers_timesess_idskeyutlsmimespeedstoreutlx509md4sha224sha512-224sha512-256sha3-224sha3-256sha3-384sha3-512shake128shake256rmd160blake2b512blake2s256sm3aes-128-cbcaes-128-ecbaes-192-cbcaes-192-ecbaes-256-cbcaes-256-ecbaria-128-cbcaria-128-cfbaria-128-ctraria-128-ecbaria-128-ofbaria-128-cfb1aria-128-cfb8aria-192-cbcaria-192-cfbaria-192-ctraria-192-ecbaria-192-ofbaria-192-cfb1aria-192-cfb8aria-256-cbcaria-256-cfbaria-256-ctraria-256-ecbaria-256-ofbaria-256-cfb1aria-256-cfb8camellia-128-cbccamellia-128-ecbcamellia-192-cbccamellia-192-ecbcamellia-256-cbccamellia-256-ecbdes3desxrc4rc4-40rc2bfcastdes-ecbdes-ededes-ede3des-cbcdes-ede-cbcdes-ede3-cbcdes-cfbdes-ede-cfbdes-ede3-cfbdes-ofbdes-ede-ofbdes-ede3-ofbseed-cbcseed-ecbseed-cfbseed-ofbrc2-cbcrc2-ecbrc2-cfbrc2-ofbrc2-64-cbcrc2-40-cbcbf-cbcbf-ecbbf-cfbbf-ofbcast5-cbccast5-ecbcast5-cfbcast5-ofbcast-cbcsm4-cbcsm4-ecbsm4-cfbsm4-ofbsm4-ctrInvalid size suffix %s buffer for output file../apps/rand.cBase64 encode outputHex encode outputNumber of bytes to generate../apps/rehash.chash bucketcollision bucketSkipping %s, can't write Doing %s Skipping %s, out of memory filename buffer%s%s%slink %s -> %s %s%s%08x.%s%d%s: Can't unlink %s, %s %s: Can't symlink %s, %s unlink %s compatDo not remove existing linkscrtcer../apps/req.c%s '%s' too long %s [%s]:req_extensionsCan't find keygen engine %s Serial number supplied twice Duplicate extension name: %s Unknown cipher: %s input_passwordoutput_passworddefault_bitsUnable to determine key type RSA-PSSError setting keysize Key parameter error "%s" Writing private key to stdout encrypt_rsa_keyencrypt_key----- X509 requestissuer cert from -CA argpromptdistinguished_nameUnable to get '%s' section _min_maxDN defaultDN valueAttribute defaultAttribute valueError adding attribute Old subject=New subject=Error getting public key Error printing certificate Modulus is unavailable Modulus=Wrong Algorithm typedefault_keyfilekeygen_engineNew requestRequest template filereqoptVarious request text optionsText form of requestx509v1CAkey(Required by some CA's)set_serialSerial number to useAn alias for -extensionsaddextprecertKeys and Signing options: Output public keyFile to write private key toDo not output REQnewhdrRSA moduluspkcs1PrivateKeyInfoNot an RSA key RSA key ok RSA key not ok writing RSA key ../apps/rsa.cVerify key consistencyRSAPublicKey_inInput is an RSAPublicKeyOutput a public keyRSAPublicKey_outOutput is an RSAPublicKeyPrint the RSA key modulusPVK options: hold rsa keyoutput rsa keyRSA operation error ../apps/rsautl.cSign with private keyEncrypt with public keyDecrypt with private keyrawUse no paddingpkcsx931Use ANSI X9.31 paddingoaepUse PKCS#1 OAEPOCSP response: no response sent response parse error psk_client_cb created identity '%s' len=%d ../apps/s_client.ccreated PSK len=%ld Error in PSK client callback hexdecodeUnexpected LDAP response No MessageID Not ExtendedResponse Not LDAPResult {help}: Get this help text DONE RECONNECTING RENEGOTIATING noreqKEYUPDATE ERROR --- Reused, --- New, --- Certificate chain %2d s: i: v:NotBefore: ; NotAfter: Server certificate Server raw public key no peer rpk available --- SCTs present (%i) SCT validation status: %s --- %s, Cipher is %s Protocol: %s Server public key is %d bit Compression: %s Expansion: %s Using Kernel TLS for sending Next protocol: (%d) ALPN protocol: No ALPN negotiated Early data was not sent Early data was rejected Early data was accepted Verify return code: %ld (%s) Keying material exporter: Label: '%s' Length: %i bytes export key Error Keying material: Can't use SSL_get_servername SERVERINFO FOR EXTENSION %dquitreconnectfinkeyuplocalhostmail.example.comcbufsbufmbufError writing file %s Not a hex number '%s' %s: Can't use both -4 and -6 Error getting proxy password client certificateclient certificate chainError adding CRL Unable to create BIO Error setting verify params Error loading CA names Error setting SRTP profile Error parsing -alpn argument Error setting ALPN Can't open session file %s Can't set session Connecting via TFO connect:errno=%d CONNECTED(%08X) getsockname:errno=%d Failed to set MTU LHLO %s EHLO %s STARTTLSSTLS BIO_read failed . CAPABILITY . STARTTLS AUTH TLS %d SSL_do_handshake() Retval %d 

<>&%-11s:%-25s
GET /'%s' contains '..' or ':' '%s' is an invalid path '%s' is a directory FILE:%s .html.php.htmError fstat '%s' Error SSL_sendfile '%s' KTLS SENDFILE '%s' OK rwrite W BLOCK GET /renegserver rev bufferCONNECTION FAILURE LOOKUP renego during accept CONNECTION CLOSED CLOSE\x%02xHostname in TLS extension: "Switching server context. psk_server_cb identity_len=%d identity=%s PSK client identity found fetched PSK len=%ld Error in PSK server callback ALPN protocols selected: Lookup session: cache hit Lookup session: cache miss get sessionError encoding session get session buffercert_status: callback called cert_status: AIA URL: %s server bufferEarly data received: No early data received End of early data shutdown accept socket SSL_do_handshake -> %d Failed to initiate requestLOOKUP renego during write Write BLOCK (Async) Write BLOCK ERROR - memory ERROR - unable to connect LOOKUP during accept %s DELAY verify error:%s Read BLOCK (Async) Read BLOCK shutting down SSL server2.pemserver.pemCan't use -rev with DTLS Can only use -tfo with TLS server certificate chainsecond server certificateerror setting 'id_prefix' id_prefix '%s' set. Setting temp DH parameters Compressing certificates Listening for TFO trace protocol messagesunlinkSet session ID contextnocertcert2key2dcertformdcert_chaindkeydkeyformdpassDH parameters file to useservername_fatalNo server outputno_resume_ephemeralwwwWWWHTTPid_prefixno_cacheDisable session cacheext_cacheDo not ignore input EOFOCSP options: status_verbosestatus_timeoutstatus_urlStatus request fallback URLstatus_filePrint more outputPrint the SSL statesOperate in asynchronous modenacceptEnable timeoutsSet link-layer MTUServer identity options: PSK identity to expectpsk_hintPSK identity hint to usesrpvfilesrpuserseedrecv_max_early_dataAttempt to read early datanum_ticketsno_anti_replayhttp_server_binmodeno_ca_namesstatelessRequire TLSv1.3 cookiesJust talk TLSv1Just talk TLSv1.1just talk TLSv1.2just talk TLSv1.3Use any DTLS versionlistenJust talk DTLSv1Just talk DTLSv1.2no_dheDisable ephemeral DHzerocopy_sendfilelocalhost:4433%s: verify depth is %d %s: -www option is too long SSL_CIPHERUnable to get connection startingConnection options: Just time new connectionsJust time connection reuseJust use TLSv1.0cafileunable to load SSL_SESSION Context too long Error setting id context No certificate present unable to write SSL_SESSION unable to write X509 Set the session ID contextPrint ssl session id detailsOutput certificate Provider: %s Key management: %s pk7outError reading S/MIME message ../apps/smime.cAction options: Output PKCS#7 structureSigning/Encryption options: Signer certificate fileEmail options: Certificate chain options: nochainSM2 verify init failure SM2 verify failure SM2 init sign failure SM2 sign failure EdDSA verify init failure EdDSA verify failure EdDSA sign init failure EdDSA sign failure ECDSA verify failure ECDSA sign failure RSA decrypt failure RSA encrypt failure RSA verify failure RSA sign failure Failed to set iv length Failed to set tag length Failed to set key and iv Failed to encrypt the data +R:%d:%s:%f %d %s ops in %.2fs %s error! sig sign loopSIG sign failure at count %d ../apps/speed.cError finalizing cipher loop Failed to set iv Failed to set tag Failed to decrypt the data Invalid cipher! +DT:%s:%d:%d +DTP:%d:%s:%s:%d +DTP:%s:%s:%d Doing %s %s ops for %ds: EC params init failure. EC key generation failure. Failure in the job Failure in the select fd buffer for do_multipipe failure Forked child %d dup failed fdopen failure with 0x%x Got: %s from %d +F:+F2:+F3:+F4:+F5:+F6:+F7:+F8:+F9:+F10:+H:Child exited with %d md2mdc2whirlpoolripemd160multiblock input buffermultiblock output bufferevp_cipher keyfailed to set cipher key failed to set AEAD key failed to get cipher name error setting random bytes evpError performing cipher op +H:%d+F:%d:%s:%.2ftype %7d bytes%-24s %11.2fk %11.2f priv+R1:%ld:%d:%.2f +R2:%ld:%d:%.2f +R3:%ld:%d:%.2f +R4:%ld:%d:%.2f +R5:%ld:%u:%.2f +R6:%ld:%u:%.2f +R7:%ld:%u:%.2f +R8:%ld:%u:%.2f +R9:%ld:%d:%.2f +R10:%ld:%u:%s:%.2f +R11:%ld:%u:%s:%.2f +R12:%ld:%u:%s:%.2f +R13:%ld:%u:%s:%.2f +R14:%ld:%d:%.2f +R15:%ld:%s:%.2f +R16:%ld:%s:%.2f +R17:%ld:%s:%.2f +R18:%ld:%s:%.2f +R19:%ld:%s:%.2f +R20:%ld:%s:%.2f %s: %s is an unknown digest %s: %s is an unknown cipher %s: multi argument too large %s: too many async_jobs %s: Maximum offset is %d ECP-256ECP-384ECP-521dsa1024dsa2048ED25519ED448ECDSASIPHASHPOLY1305CMACshaopensslffdhaescamelliaecdsaecdheddsaed25519ed448curveSM2kmaccmac%s: Unknown algorithm %s %s is not an AEAD cipher array of loopargsError: buffer size too large ECDH secret aECDH secret bFFDH secret aFFDH secret bGMACHMAC namehmac(%s)aes-128-gcm EVP_CIPHER_CTX_new failure Couldn't init the context Failed to set the key Failed to get the tag CMAC namecmac(%s)KMAC-128KMAC-256ECDH key generation failure. ECDH computation failure. EdDSA failure. TLSv1.3+GM+Cipher+SuiteSM2 init failure. FFDH key generation failure. FFDH computation failure. rsa%u%sX25519X448RSASVEDHKEMencaps resultencaps secretEncaps error for %s. KEM decaps secretDecaps error for %s. encapsdecapsSigning error for %s. Verify error for %s. Verify 2 error for %s. signsoptions: %s type +F:%u:%s%-13s+F2:%u:%u:%f:%f:%f:%f +F3:%u:%u:%f:%f +F4:%u:%u:%f:%f +F5:%u:%u:%f:%f %30sop op/s +F6:%u:%u:%s:%f:%f CurveSM2+F7:%u:%u:%s:%f:%f +F8:%u:%u:%f:%f %23sop op/s %4u bits ffdh %8.4fs %8.1f +F9:%u:%f:%f:%f +F10:%u:%f:%f:%f rsa decryptrsa encryptrsa verifyrsa signffdh2048ffdh3072ffdh4096ffdh6144ffdh8192secp160r1nistp192nistp224nistp256nistp384nistp521nistk163nistk233nistk283nistk409nistk571nistb163nistb233nistb283nistb409nistb571brainpoolP256r1brainpoolP256t1brainpoolP384r1brainpoolP384t1brainpoolP512r1brainpoolP512t1Ed25519Ed448ecdhp160ecdhp192ecdhp224ecdhp256ecdhp384ecdhp521ecdhk163ecdhk233ecdhk283ecdhk409ecdhk571ecdhb163ecdhb233ecdhb283ecdhb409ecdhb571ecdhbrp256r1ecdhbrp256t1ecdhbrp384r1ecdhbrp384t1ecdhbrp512r1ecdhbrp512t1ecdhx25519ecdhx448ecdsap160ecdsap192ecdsap224ecdsap256ecdsap384ecdsap521ecdsak163ecdsak233ecdsak283ecdsak409ecdsak571ecdsab163ecdsab233ecdsab283ecdsab409ecdsab571ecdsabrp256r1ecdsabrp256t1ecdsabrp384r1ecdsabrp384t1ecdsabrp512r1ecdsabrp512t1rsa512rsa1024rsa2048rsa3072rsa4096rsa7680rsa15360ripemdrc5-cbcrc5idea-cbcideablowfishcast5ghashkmac128kmac256hmac(sha256)mbmrRun benchmarks in parallelasync_jobsmlocktestmodeSelection options: HMAC using EVP-named digestCMAC using EVP-named cipheraeadBenchmark KEM algorithmsTiming options: elapsedmisalignMD5Error setting public key Error signing SPKAC ../apps/spkac.cSPKAC=%s Can't find SPKAC called "%s" Error loading SPKAC Signature OK Signature Failure spksectchallengeChallenge stringAlternative SPKAC nameDon't print SPKACVerify SPKAC signaturePass %s ../apps/srp.c%s "%s" %d = "%s" User entryg N entryNeed at least one user. default_srpDatabase initialised Default g and NStarting user processing Processing user "%s" List all users user "%s" reactivated. row pointersfailed to update srpvfile Password for user "%s" ok. user "%s" revoked. t User procession done. Trying to update srpvfile. Temporary srpvfile created. srpvfile updated. User errors %d. Talk a lot while doing thingsAdd a user and SRP verifiermodifydeleteList usersThe srp verifier file nameuserinfo%*sCouldn't open file or uri %s %d: %s: %s %d: %s !!! Unknown code Total found: %d %s: criterion already given. %s: subject already given. %s: issuer already given. %s: alias already given. ../apps/storeutl.cURIUsage: %s [options] uri Search options: Search for certificates onlySearch for keys onlycrlsSearch for CRLs onlySearch by subjectSearch by aliasRecurse through namesNo PEM output, just statusURI of the store objectdigest buffer../apps/ts.cError getting password. Using configuration from %s cannot convert %s to OID nonce buffercould not create nonce could not create query Response is not generated. Verification: invalid digest string Error loading directory %s Error loading file %s Error loading store URI %s extra untrusted certsFAILEDResponse has been generated. Typical uses: [-text] [-engine id]Configuration fileFile with signer CA chainFile with trusted CA certsPath to trusted CA filesURI to trusted CA storeExtra untrusted certstoken_inInput is a PKCS#7 filetoken_outOutput is a PKCS#7 fileQuery options: Generate a TS queryFile to hashDigest (as a hex string)queryfileFile containing a TS queryPut cert request into queryVerify options: Verify a TS responseGenerate a TS replytspolicyPolicy OID to useDo not include a nonceOutput text (not DER)[CRL path] %s: OK Chain: depth=%d: (untrusted) %-15s %s other CRLsCRLfileshow_chainN/AOpenSSL 3.5.1 1 Jul 2025%s (Library: %s) options: Seeding source: %s Show all dataShow build dateShow configuration directoryShow engines directoryShow modules directoryShow compiler flags usedShow target build platformShow random seeding optionsShow library versionShow CPU settings info CASHA1Invalid date format: %s explicitly set public keycertificate request inputserial# buffer../apps/x509.cserial= Certificate purposes: %s%s : Yes No Yes (WARNING code=%d) notBefore=notAfter=Unknown digest No extensions in certificate Invalid extension names: %s Certificate will expire Certificate will not expire Unable to write certificate x509toreqSame as -keycertoptPrint certificate aliasPrint serial number valuePrint the notBefore fieldPrint the notAfter fieldPrint subject DNPrint email address(es)subject_hashPrint subject hash valuesubject_hash_oldissuer_hashPrint issuer hash valueissuer_hash_oldocspidocsp_uriPrint OCSP Responder URL(s)checkendcheckhostcheckemailcheckipCertificate output options: next_serialpreserve_datesset_issuerAlias for -set_subjectforce_pubkeyclrextMicro-CA options: CAformCAkeyformCAserialCAcreateserialtrustoutsetaliasclrtrustClear all trusted purposesaddtrustclrrejectaddrejectnullunknown typeintegerUTF8 encoded stringoctet stringunsigned pointer to a pointer to an %*sEmpty list of %s (!!!) %*s%s: [%d] (arbitrary size) (max %zu bytes large)%*s %s %*s%s: %llu error getting value %lld <%zu bytes> ../apps/lib/app_provider.cRANDFILECan't load %s into RNG ../apps/lib/app_rand.cCan't duplicate %s Cannot write random bytes: ../apps/lib/app_x509.chexdistiderror: allocation failed ../apps/lib/apps.chas expirednot yet validis not a CA certab%s Policies: %s: Can't load %s: Error on line %ld of config file "%s" config inputoid_sectionargv spacerfc_822iso_8601copycopyall 0x000x%02X, }; unsigned char %s[%d] = { }; 0x%02X, File name too long %s.%sUnable to rename %s to %s %s.attr%s.attr.%sUnable to open '%s' unique_subject = %s %s: Out of memory TrueFalseRequire explicit Policy: %s AuthorityUserNPN buffer NOTsubjectKeyIdentifierkeyid, issuerauthorityKeyIdentifiermissing SSL_CTXHARNESS_OSSL_PREFIXappending(doing something)Can't open %s, %s Can't open "%s" for %s, %s No configuration used calling fstat(%s)new DBpass:env:No environment variable %s file:Can't open file %s Can't open BIO for stdin Out of memory loadinginput-typeInternal error trying to loadError readingCould not find of %s from %shttps://http://Unable to load %s from %s CRL via CDPUnable to load %s Error reading mem buffer allocate async fdstodaystart dateend dateWarningParameter %s '%s' asymmetricGenerating %s key with %d bits %s: Error generating %s key esc_2253esc_2254esc_ctrlesc_msbuse_quoteignore_typeshow_typedump_alldump_nostrdump_dersep_comma_plussep_comma_plus_spacesep_semi_plus_spacesep_multilinedn_revnofnamesnamelnamespace_eqdump_unknownRFC2253onelineca_defaultcompatibleno_headerno_versionno_serialno_signameno_validityno_subjectno_issuerno_pubkeyno_extensionsno_sigdumpno_auxno_attributesext_defaultext_errorext_parseext_dumppass phrase../apps/lib/apps_ui.cUser interface error aborted! autoEnabling auto ENGINE support dynamicSO_PATHLOADInvalid engine "%s" SET_USER_INTERFACECannot use engine "%s" Engine "%s" set. ../apps/lib/engine.corg.openssl.engine:../apps/lib/engine_loader.corg.openssl.engine../apps/lib/http_server.c (core dumped)child PID arraywaitpid() failed: %sRAND_poll() failedterminating on signal: %d*:%serror setting up accept BIOerror printing ACCEPT stringConnection: keep-alive sending response header: %sHTTP/1.0 %d %s GET or cannot get port listening onawaiting next request ...request line read errorBad RequestPOST HTTP/1.error reading HTTP headerConnectionkeep-aliveclosereceived request header:Invalid verbosity level %d{ }a hexadecimal0Xan octalvalinfileoutfile+intulongPEM|DER|ENGINEPEM|DERnonneguintmaxparm%s: Bad format "%s" B64b64BASE64NSSnsspvkP12p12PKCS12(undefined)TEXT%s XTS ciphers not supported %s: Value must be one of: ../apps/lib/opt.cassertion failed: vpm != NULL%s: Invalid Policy %s %s: Invalid purpose %s %s: Invalid verify name %s %s: Missing argument: %s %s: Extra option: "%s" (No additional info)-*Usage: %s [options] Valid options are: Parameters: %s %s %s: Option -%s needs a value %s: Not a directory: %s %s: Unknown option: -%s msblobhttpgost2001gost2012_256gost2012_512NOT OKNOT OK Suite B: %s: %s not tested Security callback: Version=%s%s=Public key missing%s, bits=%d digest=%s, algorithm=%s scheme=unknown(0x%04x), security bits=%d scheme=%sprepend certShared Requested Signature Algorithms: rsa_pss_pss_sha256rsa_pss_pss_sha384rsa_pss_pss_sha512ecdsa_brainpoolP256r1_sha256ecdsa_brainpoolP384r1_sha384ecdsa_brainpoolP512r1_sha512+%s+0x%02Xdepth=%d verify error:num=%d:%s issuer= verify return:%d error setting certificate error setting private key Client Certificate Types: UNKNOWN (%d),Peer signing digest: %s Peer signature type: %s ansiX962_compressed_primeansiX962_compressed_char2unknown(%d)groups to printSupported groups: ../apps/lib/s_cb.c Shared groups: Negotiated TLS1.3 group: %s Peer Temp Key: RSA, %d bits DH, %d bits ECDH, %s, %d bits SSL_connectSSL_acceptundefinedreadwriteSSL3 alert %s:%s:%s %s:failed in %s %s:error in %s >>><<<, ???, warning, fatal, RecordHeader, ChangeCipherSpec, ApplicationData, Alert, InnerContent, Handshake, Unknown (content_type=%d)%s %s%s [length %04lx]%s%s %02xserver namememory full Failed getting peer address assertion failed: length != 0cookie generate bufferMissing filename Server Certificateserver keyserver chain%s: Key already specified %s: Chain already specified matched the EEsigned the peermatched the TAVerification: OK Verified peername: %s Verification error: %s TLSA hex data buffer0123456789abcdefDANE TLSA %d %d %d %s%s %s certificate at depth %d Protocol version: %s assertion failed: num == 2Client cipher list: Ciphersuite: %s Peer certificate: Hash used: %s Signature type: %s Peer used raw public key Error finishing context Error writing keylog file %s Supported CiphersuiteShared CiphersuiteCheck CiphersuiteTemp DH key bitsSupported CurveShared CurveCheck CurveSupported Signature AlgorithmShared Signature AlgorithmCheck Signature AlgorithmSignature Algorithm maskCertificate chain EE keyCertificate chain CA keyPeer Chain EE keyPeer Chain CA keyCertificate chain CA digestPeer chain CA digestSSL compressionSession ticketOverall ValiditySign with EE keyEE signatureCA signatureEE key parametersCA key parametersExplicitly sign with EE keyIssuer NameCertificate TypeSHA224SHA384SHA512anonymousrsa_pkcs1_sha1ecdsa_sha1rsa_pkcs1_sha256ecdsa_secp256r1_sha256rsa_pkcs1_sha384ecdsa_secp384r1_sha384rsa_pkcs1_sha512ecdsa_secp521r1_sha512rsa_pss_rsae_sha256rsa_pss_rsae_sha384rsa_pss_rsae_sha512gostr34102001gostr34102012_256gostr34102012_512max fragment lengthclient certificate URLtrusted CA keystruncated HMACstatus requestuser mappingclient authzserver authzsupported_groupsEC point formatsSRPuse SRTPsession ticketrenegotiation infosigned certificate timestampsclient cert typeserver cert typeTLS paddingnext protocolencrypt-then-macextended master secretcompress certificatekey sharesupported versionspsk kex modescertificate authoritiespost handshake auth, HelloRequest, ClientHello, ServerHello, HelloVerifyRequest, NewSessionTicket, EndOfEarlyData, EncryptedExtensions, Certificate, ServerKeyExchange, CertificateRequest, ServerHelloDone, CertificateVerify, ClientKeyExchange, Finished, CertificateUrl, CertificateStatus, SupplementalData, KeyUpdate, CompressedCertificate, NextProto, MessageHash close_notify end_of_early_data unexpected_message bad_record_mac decryption_failed record_overflow decompression_failure handshake_failure bad_certificate unsupported_certificate certificate_revoked certificate_expired certificate_unknown illegal_parameter unknown_ca access_denied decode_error decrypt_error export_restriction protocol_version insufficient_security internal_error inappropriate_fallback user_canceled no_renegotiation missing_extension unsupported_extension certificate_unobtainable unrecognized_name bad_certificate_hash_value unknown_psk_identity certificate_requiredSSL 3.0TLS 1.1TLS 1.2TLS 1.3DTLS 1.0DTLS 1.0 (bad)RSA signRSA fixed DHDSS fixed DHECDSA signRSA fixed ECDHECDSA fixed ECDHGOST01 SignGOST12 SignIPv4 IPv6 unix ../apps/lib/s_socket.cInternal error Connecting to %s %s:%s [%s]:%sACCEPTunknown:error PID=%dSRP parameters: N= g=SRP param N and g rejected. SRP password bufferSRP user../apps/lib/tlssrp_depr.cSRP username = "%s" User %s doesn't exist Unable to set SRP username LOOKUP done %s LOOKUP not successful process_cert_requestprocess_rrcheck_client_crlprocess_genmprocess_errorprocess_certConfprocess_pollReqdelayed_deliveryclean_transactionossl_cmp_mock_srv_set_checkAfterTimeossl_cmp_mock_srv_set_pollCountossl_cmp_mock_srv_set_sendErrorossl_cmp_mock_srv_set_statusInfoossl_cmp_mock_srv_set1_oldWithNewossl_cmp_mock_srv_set1_newWithOldossl_cmp_mock_srv_set1_newWithNewossl_cmp_mock_srv_set1_caPubsOutossl_cmp_mock_srv_set1_chainOutossl_cmp_mock_srv_set1_crlOutossl_cmp_mock_srv_set1_keyOutossl_cmp_mock_srv_set1_certOutossl_cmp_mock_srv_set1_refCert%s: Memory allocation failure input format - one of DER PEM B64output file (output format is always DER)offset; a series of these can be used to 'dig'string to generate ASN1 structure frominto multiple ASN1 blob wrappingsfile to generate ASN1 structure fromequivalent to '-inform pem' (obsolete)dump the first arg bytes of unknown data in hex formAdding Entry with serial number %s to DB for %s ERROR:Already present, serial number %s ERROR:Already revoked, serial number %s Invalid time format %s. Need YYYYMMDDHHMMSSZ Error in revocation arguments variable lookup failed for %s::%s invalid type, Database error The Subject's Distinguished Name is as follows emailAddress type needs to be of type IA5STRING The string contains characters that are illegal for the ASN.1 type %s:unknown object type in 'policy' configuration The %s field needed to be supplied and was missing The mandatory %s field was missing The %s field does not exist in the CA certificate, the 'policy' is misconfigured The %s field is different between CA certificate (%s) and the request (%s) %s:invalid type in 'policy' configuration Everything appears to be ok, creating and signing the certificate Warning: Signature key and public key of cert do not match Extra configuration file found Error adding certificate extensions from extfile section %s Successfully added extensions from file. The subject name appears to be ok, checking database for clashes ERROR: adding extensions from request Error adding certificate extensions from config section %s Successfully added extensions from config ERROR:There is already a certificate for %s ERROR:Serial number %s has already been issued, check the database/serial_file for corruption The matching entry has the following details Certificate is to be certified until CERTIFICATE WILL NOT BE CERTIFIED: I/O error CERTIFICATE WILL NOT BE CERTIFIED Check that the request matches the signature Certificate request and CA private key do not match Signature verification problems... Signature did not match the certificate request Invalid global string mask setting %s Problem with index file: %s (could not load/parse file) CA certificate and CA private key do not match Invalid certificate options: "%s" Invalid extension copy option: "%s" there needs to be defined a directory for new certificate to be placed in entry %d: not revoked yet, but has a revocation date entry %d: invalid expiry date entry %d: bad serial number length (%d) entry %d: bad char 0%o '%c' in serial number %d entries loaded from the database No entries found to mark expired Done. %d entries marked as expired Successfully loaded extensions file %s Error checking certificate extensions from extfile section %s Error checking certificate extension config section %s cannot lookup how many days to certify for Warning: -enddate or -not_after option overriding -days option error generating serial number error while loading serial number unable to find 'section' for %s no name/value pairs found in %s unable to load Netscape SPKAC structure Netscape SPKAC structure not found in %s Check that the SPKAC request matches the signature error unpacking SPKAC public key signature verification failed on SPKAC public key Signature verification problems.... Signature did not match the certificate %d out of %d certificate requests certified, commit? [y/n]CERTIFICATION CANCELED: I/O error Write out database with %d new entries certificate file name too long Error checking CRL extension section %s error while loading CRL number cannot lookup how long until the next CRL is issued Error adding CRL extensions from section %s Usage: %s [options] [certreq...] Verbose output during processingTerse output during processingCSR input format to use (PEM or DER; by default try PEM first)The last argument, requests to processWhere to put the output file(s)Datetime format used for printing. (rfc_822/iso_8601). Default is rfc_822.Do not print the generated certificatemsie modifications to handle all Universal StringsFile contains a self signed cert to signFile contains DN and signed public key and challengeUse engine, possibly a hardware deviceThe particular CA definition to useUse arg instead of request's subjectInput characters are UTF8; default ASCIIIf reading serial fails, create a new random serialAlways create a random serial; do not store itDeprecated; multi-valued RDNs support is always on.[CC]YYMMDDHHMMSSZ value for notBefore certificate field[CC]YYMMDDHHMMSSZ value for notAfter certificate field, overrides -daysNumber of days from today to certify the cert forExtension section (override value in config file)Configuration file with X509v3 extensions to addDon't add the EMAIL field to the DNPrivate key file format (ENGINE, other values ignored)Key and cert input file pass phrase sourceKey to decrypt the private key or cert files if encrypted. Better use -passinCertificate input format (DER/PEM/P12); has no effectSign a cert with the key associated with itSignature parameter in n:v formVerification parameter in n:v formAdd a Valid(not-revoked) DB entry about a cert (given in file)Shows cert status given the serial numberCRL extension section (override value in config file)the hold instruction, an OID. Sets revocation reason to certificateHoldsets compromise time to val and the revocation reason to keyCompromisesets compromise time to val and the revocation reason to CACompromiseSets the CRL lastUpdate time to val (YYMMDDHHMMSSZ or YYYYMMDDHHMMSSZ)Sets the CRL nextUpdate time to val (YYMMDDHHMMSSZ or YYYYMMDDHHMMSSZ)Days until the next CRL is dueHours until the next CRL is dueSeconds until the next CRL is dueLoad the given file(s) into the random number generatorWrite random data to the specified fileProvider load path (must be before 'provider' argument if required)Provider to load (can be specified multiple times)Set a provider key-value parameterProperty query used when fetching algorithmsCertificate requests to be signed (optional)Error setting TLSv1.3 ciphersuites 0x%02X,0x%02X,0x%02X,0x%02X - Verbose listing of the SSL/TLS ciphersConvert standard name into OpenSSL nameCipher specification options: Ciphers compatible with TLS1.1Ciphers compatible with TLS1.2Ciphers compatible with TLS1.3Include ciphersuites requiring PSK(deprecated) Include ciphersuites requiring SRPConfigure the TLSv1.3 ciphersuites to useCipher string to decode (optional)%s:%s:%d:CMP %s: %s option argument is empty string, resetting option%s%s %s:%s:%d:CMP %s: %s option argument starts with hyphen%s%s error setting verification parameters for %s %s:%s:%d:CMP %s: NULL arg to write_PKIMESSAGE%s%s%s %s:%s:%d:CMP %s: not enough file names provided for writing PKIMessage%s%s%s %s:%s:%d:CMP %s: cannot write PKIMessage to file '%s'%s%s %s:%s:%d:CMP %s: NULL arg to read_PKIMESSAGE%s%s%s %s:%s:%d:CMP %s: not enough file names provided for reading PKIMessage%s%s%s %s:%s:%d:CMP %s: cannot read PKIMessage from file '%s'%s%s %s:%s:%d:CMP %s: cannot write request PKIMessage to file '%s'%s%s %s:%s:%d:CMP %s: too few -rspin filename arguments; resorting to using mock server%s%s%s %s:%s:%d:CMP %s: missing -server or -use_mock_srv option, or too few -rspin filename arguments%s%s%s %s:%s:%d:CMP %s: too few -rspin filename arguments; resorting to contacting server%s%s%s %s:%s:%d:CMP %s: failed to load ir/cr/kur file '%s' attempting to get fallback public key%s%s %s:%s:%d:CMP %s: failed to get fallback public key from ir/cr/kur file '%s'%s%s %s:%s:%d:CMP %s: failed to get fallback public key obtained from ir/cr/kur file '%s'%s%s %s:%s:%d:CMP %s: out of memory%s%s%s specifications contained in keySpec from genp%s:%s:%d:CMP %s: Out of memory - cannot dump key %s%s%s %s:%s:%d:CMP %s: Info too large - cannot dump key %s%s%s %s:%s:%d:CMP %s: received %d %s certificate(s), saving to file '%s' %s:%s:%d:CMP %s: saving more than one certificate in non-PEM format%s%s%s %s:%s:%d:CMP %s: could not open file '%s' for %s %s certificate(s) error: unsupported type '%s' for writing certificates %s:%s:%d:CMP %s: cannot write %s certificate to file '%s'%s %s:%s:%d:CMP %s: using only first %d characters of section name starting with "%.*s" %s:%s:%d:CMP %s: Failed to delete %s, which should be done to indicate there is no %s%s assertion failed: OSSL_NELEM(cmp_vars) == n_options + OPT_PROV__FIRST + 1 - OPT_PROV__LAST + OPT_R__FIRST + 1 - OPT_R__LAST + OPT_V__FIRST + 1 - OPT_V__LASTNon-positive number "%ld" for config option -%s Negative number "%ld" for config option -%s %s:%s:%d:CMP %s: internal: unsupported type '%c' for option '%s'%s %s:%s:%d:CMP %s: for option '%s' in config file section '%s'%s integer value out of range for option '%s' %s:%s:%d:CMP %s: -tls_used given without -tls_trusted; will not authenticate the TLS server%s%s%s TLS client certificate (optionally with chain)%s:%s:%d:CMP %s: unable to use client TLS certificate file '%s'%s%s %s:%s:%d:CMP %s: could not add untrusted cert to TLS client cert chain%s%s%s %s:%s:%d:CMP %s: trying to build cert chain for own TLS cert%s%s%s %s:%s:%d:CMP %s: success building cert chain for own TLS cert%s%s%s %s:%s:%d:CMP %s: could not build cert chain for own TLS cert%s%s%s error: unable to add TLS extra certs %s:%s:%d:CMP %s: TLS private key '%s' does not match the TLS certificate '%s' %s %s:%s:%d:CMP %s: unable to use TLS client private key '%s'%s%s %s:%s:%d:CMP %s: -tls_used given without -tls_key; cannot authenticate to the TLS server%s%s%s %s:%s:%d:CMP %s: must give -key or -secret unless -unprotected_requests is used%s%s%s %s:%s:%d:CMP %s: must give -ref if no -cert and no -subject given%s%s%s %s:%s:%d:CMP %s: must give both -cert and -key options or neither%s%s%s %s:%s:%d:CMP %s: -cert and -key not used for protection since -secret is given%s%s%s private key for CMP client certificate%s:%s:%d:CMP %s: will not authenticate server due to missing -secret, -trusted, or -srvcert%s%s%s CMP client certificate (optionally with chain)trusted certs for verifying own CMP signer cert%s:%s:%d:CMP %s: -own_trusted option is ignored without -cert%s%s%s %s:%s:%d:CMP %s: digest algorithm name not recognized: '%s'%s%s %s:%s:%d:CMP %s: digest algorithm name not supported: '%s'%s%s %s:%s:%d:CMP %s: MAC algorithm name not recognized: '%s'%s%s , and -key option superseded by -csrfallback public key for cert to be enrolledpublic key for checking cert resulting from p10crreference certificate (oldcert) only if -rspin argument gives too few filenames%s:%s:%d:CMP %s: missing -server or -use_mock_srv or -rspin option%s%s%s %s:%s:%d:CMP %s: ignoring -proxy option since -server is not given%s%s%s %s:%s:%d:CMP %s: ignoring -no_proxy option since -server is not given%s%s%s %s:%s:%d:CMP %s: cannot parse -server URL: %s%s%s %s:%s:%d:CMP %s: assuming -tls_used since -server URL indicates HTTPS%s%s%s %s:%s:%d:CMP %s: unknown cmp command '%s'%s%s %s:%s:%d:CMP %s: no cmp command to execute%s%s%s %s:%s:%d:CMP %s: unknown option given for key loading format%s%s%s %s:%s:%d:CMP %s: unknown option given for certificate storing format%s%s%s %s:%s:%d:CMP %s: unknown option given for CRL storing format%s%s%s %s:%s:%d:CMP %s: no -infotype option given for genm%s%s%s %s:%s:%d:CMP %s: -infotype option is ignored for commands other than 'genm'%s%s%s %s:%s:%d:CMP %s: unknown OID name in -infotype option%s%s%s %s:%s:%d:CMP %s: -oldwithold %s%s%s option is ignored unless -cmd 'genm' and -infotype rootCaCert is given%s:%s:%d:CMP %s: -newwithnew %s%s%s %s:%s:%d:CMP %s: -newwithold %s%s%s %s:%s:%d:CMP %s: -oldwithnew %s%s%s %s:%s:%d:CMP %s: -template %s%s%s option is ignored unless -cmd 'genm' and -infotype 'certReqTemplate' is given%s:%s:%d:CMP %s: -keyspec %s%s%s %s:%s:%d:CMP %s: missing -template option for genm with infotype certReqTemplate%s%s%s %s:%s:%d:CMP %s: -trusted option is ignored since -srvcert option is present%s%s%s %s:%s:%d:CMP %s: -recipient option is ignored since -srvcert option is present%s%s%s directly trusted CMP server certificatetrusted certs for verifying newly enrolled cert%s:%s:%d:CMP %s: -total_timeout argument = %d must not be < %d (-msg_timeout)%s %s:%s:%d:CMP %s: -reqin is ignored since -rspin is present%s%s%s %s:%s:%d:CMP %s: -reqin_new_tid is ignored since -reqin is not present%s%s%s %s:%s:%d:CMP %s: missing -tls_key option%s%s%s %s:%s:%d:CMP %s: missing -tls_cert option%s%s%s %s:%s:%d:CMP %s: no -subject given; no -csr or -oldcert or -cert available for fallback%s%s%s %s:%s:%d:CMP %s: missing -newkey (or -key) to be certified and no -csr, -oldcert, -cert, or -reqin option given, which could provide fallback public key. Neither central key generation is requested.%s%s%s %s:%s:%d:CMP %s: POPO is disabled, which implies -centralkeygen%s%s%s %s:%s:%d:CMP %s: -popo value %d is inconsistent with -centralkeygen%s%s %s:%s:%d:CMP %s: -newkeyout not given, nowhere to save centrally generated key%s%s%s %s:%s:%d:CMP %s: no -newkey option given with private key for POPO, -csr option provides just public key%s%s%s %s:%s:%d:CMP %s: since -reqin is used, may use -popo -1 or -popo 0 to disable the needless generation of a POPO%s%s%s %s:%s:%d:CMP %s: missing -newkey (or -key) option for key to be certified and for POPO%s%s%s %s:%s:%d:CMP %s: -certout not given, nowhere to save newly enrolled certificate%s%s%s %s:%s:%d:CMP %s: -subject %s since sender is taken from -ref or -cert%s%s option is ignored for commands other than 'ir', 'cr', and 'kur'%s:%s:%d:CMP %s: -issuer %s and 'rr'%s%s %s:%s:%d:CMP %s: -reqexts %s%s%s %s:%s:%d:CMP %s: -san_nodefault %s%s%s %s:%s:%d:CMP %s: -sans %s%s%s %s:%s:%d:CMP %s: -policies %s%s%s %s:%s:%d:CMP %s: -policy_oids %s%s%s %s:%s:%d:CMP %s: -popo %s%s%s %s:%s:%d:CMP %s: -popo -1 or -centralkeygen %s%s%s %s:%s:%d:CMP %s: -newkeyout %s%s%s %s:%s:%d:CMP %s: -implicit_confirm %s, and 'p10cr'%s%s %s:%s:%d:CMP %s: -disable_confirm %s, and 'p10cr'%s%s %s:%s:%d:CMP %s: -certout %s, and 'p10cr'%s%s %s:%s:%d:CMP %s: -chainout %s, and 'p10cr'%s%s %s:%s:%d:CMP %s: missing -oldcert for certificate to be updated and no -csr given%s%s%s %s:%s:%d:CMP %s: given -subject '%s' overrides the subject of '%s' for KUR%s %s:%s:%d:CMP %s: missing -oldcert or -issuer and -serial for certificate to be revoked and no -csr given%s%s%s %s:%s:%d:CMP %s: ignoring -csr since certificate to be revoked is given%s%s%s %s:%s:%d:CMP %s: Must give both -issuer and -serial options or neither%s%s%s %s:%s:%d:CMP %s: Ignoring -oldcert since -issuer and -serial is given for command 'rr'%s%s%s %s:%s:%d:CMP %s: Ignoring -csr since -issuer and -serial is given for command 'rr'%s%s%s %s:%s:%d:CMP %s: cannot read serial number: '%s'%s%s %s:%s:%d:CMP %s: Ignoring -serial for command other than 'rr'%s%s%s %s:%s:%d:CMP %s: missing PKCS#10 CSR for p10cr%s%s%s %s:%s:%d:CMP %s: missing -recipient, -srvcert, -issuer, -oldcert or -cert; recipient for any requests not covered by -reqin will be set to "NULL-DN"%s%s%s %s:%s:%d:CMP %s: -newkeypass %s%s%s option is ignored for 'p10cr', 'rr', and 'genm' commands%s:%s:%d:CMP %s: -newkey %s%s%s %s:%s:%d:CMP %s: -days %s%s%s %s:%s:%d:CMP %s: -out_trusted %s%s%s new private key for cert to be enrolled%s:%s:%d:CMP %s: could not set requested cert validity period%s%s%s %s:%s:%d:CMP %s: cannot have policies both via -policies and via -policy_oids%s%s%s %s:%s:%d:CMP %s: -csr option is ignored for 'genm' command%s%s%s %s:%s:%d:CMP %s: cannot load certificate request extension section '%s'%s%s %s:%s:%d:CMP %s: cannot load policy cert request extension section '%s'%s%s %s:%s:%d:CMP %s: cannot have Subject Alternative Names both via -reqexts and via -sans%s%s%s %s:%s:%d:CMP %s: bad syntax of %s '%s'%s %s:%s:%d:CMP %s: -opt_san_nodefault has no effect when -sans is used%s%s%s %s:%s:%d:CMP %s: -opt_policy_oids_critical has no effect unless -policy_oids is given%s%s%s %s:%s:%d:CMP %s: Invalid -policy_oids arg '%s'%s%s %s:%s:%d:CMP %s: Unknown -policy_oids arg: %.40s%s%s %s:%s:%d:CMP %s: cannot add policy with OID '%s'%s%s %s:%s:%d:CMP %s: -oldcert option is ignored for 'genm' command%s%s%s %s:%s:%d:CMP %s: Missing ':' in -geninfo arg %.40s%s%s %s:%s:%d:CMP %s: Invalid OID in -geninfo arg %.40s%s%s %s:%s:%d:CMP %s: Unknown OID in -geninfo arg: %.40s%s%s %s:%s:%d:CMP %s: Cannot parse int in -geninfo arg %.40s%s%s %s:%s:%d:CMP %s: Missing ',' or end of -geninfo arg after int at %.40s%s%s %s:%s:%d:CMP %s: Missing 'int:' or 'str:' in -geninfo arg %.40s%s%s %s:%s:%d:CMP %s: Unable to create 'OSSL_CMP_ITAV' structure%s%s%s %s:%s:%d:CMP %s: Failed to add ITAV for geninfo of the PKI message header%s%s%s %s:%s:%d:CMP %s: will contact %s%s%s %s:%s:%d:CMP %s: must give -srv_ref for mock server if no -srv_cert given%s%s%s %s:%s:%d:CMP %s: server credentials (-srv_secret or -srv_cert) must be given if -use_mock_srv or -port is used%s%s%s %s:%s:%d:CMP %s: server will not be able to handle PBM-protected requests since -srv_secret is not given%s%s%s %s:%s:%d:CMP %s: must give both -srv_cert and -srv_key options or neither%s%s%s signer certificate of the mock serverprivate key for mock server cert%s:%s:%d:CMP %s: mock server will not be able to handle signature-protected requests since -srv_trusted is not given%s%s%s untrusted certificates for mock serverreference cert to be expected by the mock server%s:%s:%d:CMP %s: no -rsp_cert given for mock server%s%s%s cert the mock server returns on certificate requestsprivate key for enrollment certCRL to be returned by the mock serverCMP extra certificates for mock serverNewWithNew cert the mock server returns in rootCaKeyUpdateNewWithOld cert the mock server returns in rootCaKeyUpdateOldWithNew cert the mock server returns in rootCaKeyUpdate%s:%s:%d:CMP %s: -failure out of range, should be >= 0 and <= %d%s%s %s:%s:%d:CMP %s: -failurebits overrides -failure%s%s%s %s:%s:%d:CMP %s: -failurebits out of range%s%s%s %s:%s:%d:CMP %s: Logging verbosity level %d out of range (0 .. 8)%s%s %s:%s:%d:CMP %s: using section(s) '%s' of OpenSSL configuration file '%s'%s %s:%s:%d:CMP %s: no [%s] section found in config file '%s'; will thus use just [default] and unnamed section if present%s %s:%s:%d:CMP %s: no [%s] section found in config file '%s'%s %s:%s:%d:CMP %s: -keep_alive argument must be 0, 1, or 2%s%s%s %s:%s:%d:CMP %s: invalid popo spec. Valid values are -1 .. 2%s%s%s %s:%s:%d:CMP %s: invalid revreason. Valid values are -1 .. 6, 8 .. 10%s%s%s %s:%s:%d:CMP %s: cannot load engine %s%s%s %s:%s:%d:CMP %s: cannot set up error reporting and logging for %s%s%s %s:%s:%d:CMP %s: -tls_used given without any other TLS options%s%s%s %s:%s:%d:CMP %s: ignoring TLS options(s) since -tls_used is not given%s%s%s %s:%s:%d:CMP %s: -tls_used option not supported with -port option%s%s%s %s:%s:%d:CMP %s: The -port option excludes -server and -use_mock_srv%s%s%s %s:%s:%d:CMP %s: The -port option does not support -reqin and -reqout%s%s%s %s:%s:%d:CMP %s: The -port option does not support -rspin and -rspout%s%s%s %s:%s:%d:CMP %s: cannot use both -server and -use_mock_srv options%s%s%s %s:%s:%d:CMP %s: ignoring -tls_used option since -use_mock_srv is given or -server is not given%s%s%s %s:%s:%d:CMP %s: expecting empty path or 'pkix/' but got '%s'%s%s %s:%s:%d:CMP %s: -server %s%s%s option is ignored since -reqout_only option is given%s:%s:%d:CMP %s: -use_mock_srv %s%s%s %s:%s:%d:CMP %s: -reqout %s%s%s %s:%s:%d:CMP %s: -rspin %s%s%s %s:%s:%d:CMP %s: -rspout %s%s%s %s:%s:%d:CMP %s: -server option is not used if enough filenames given for -rspin%s%s%s %s:%s:%d:CMP %s: -use_mock_srv option is not used if enough filenames given for -rspin%s%s%s %s:%s:%d:CMP %s: cannot set up CMP context%s%s%s %s:%s:%d:CMP %s: Missing -cacertsout option for -infotype caCerts%s%s%s %s:%s:%d:CMP %s: no CA certificates provided by server%s%s%s %s:%s:%d:CMP %s: Failed to store CA certificates from genp in %s%s%s %s:%s:%d:CMP %s: Missing -newwithnew option for -infotype rootCaCert%s%s%s %s:%s:%d:CMP %s: No -oldwithold given, will use all certs given with -trusted as trust anchors for verifying the newWithNew cert%s%s%s OldWithOld cert for genm with -infotype rootCaCert%s:%s:%d:CMP %s: no root CA certificate update available%s%s%s %s:%s:%d:CMP %s: oldWithNew certificate received in genp for verifying oldWithOld, but oldWithOld was not provided%s%s%s %s:%s:%d:CMP %s: Missing -oldcrl and no -crlcert given for -infotype crlStatusList%s%s%s %s:%s:%d:CMP %s: Missing -crlout for -infotype crlStatusList%s%s%s Cert for genm with -infotype crlStatusListCRL for genm with -infotype crlStatusList%s:%s:%d:CMP %s: -oldcrl and -crlcert have different issuer%s%s%s %s:%s:%d:CMP %s: no CRL update available%s%s%s %s:%s:%d:CMP %s: received %s, saving to file '%s'%s %s:%s:%d:CMP %s: could not open file '%s' for writing %s%s error: unsupported type '%s' for writing CRLs %s:%s:%d:CMP %s: cannot write %s to file '%s'%s %s:%s:%d:CMP %s: no certificate request template available%s%s%s %s:%s:%d:CMP %s: error saving certTemplate from genp: cannot open file %s%s%s %s:%s:%d:CMP %s: error saving certTemplate from genp: cannot write file %s%s%s %s:%s:%d:CMP %s: stored certTemplate from genp to file '%s'%s%s %s:%s:%d:CMP %s: no key specifications available%s%s%s %s:%s:%d:CMP %s: error saving keySpec from genp: cannot open file %s%s%s %s:%s:%d:CMP %s: error saving keySpec from genp: cannot write file %s%s%s %s:%s:%d:CMP %s: stored keySpec from genp to file '%s'%s%s %s:%s:%d:CMP %s: No specific support for -infotype %s available%s%s %s:%s:%d:CMP %s: Failed to create genm for -infotype %s%s%s %s:%s:%d:CMP %s: genp does not contain any ITAV%s%s%s %s:%s:%d:CMP %s: could not get ITAV #%d from genp%s%s %s:%s:%d:CMP %s: error parsing type of ITAV #%d from genp%s%s %s:%s:%d:CMP %s: ITAV #%d from genp infoType=%s%s %s:%s:%d:CMP %s: Did not receive response on genm or genp is not valid%s%s%s %s:%s:%d:CMP %s: received%s%s %s Centrally generated private key password%s:%s:%d:CMP %s: saving centrally generated key to file '%s'%s%s Configuration file to use. "" = none. Default from env variable OPENSSL_CONFSection(s) in config file to get options from. "" = 'default'. Default 'cmp'Log level; 3=ERR, 4=WARN, 6=INFO, 7=DEBUG, 8=TRACE. Default 6 = INFOCMP request to send: ir/cr/kur/p10cr/rr/genmInfoType name for requesting specific info in genm, with specific supportfor 'caCerts' and 'rootCaCert'Certificate profile name to place in generalInfo field of request PKIHeaderComma-separated list of OID and value to place in generalInfo PKIHeaderof form :int: or :str:, e.g. '1.2.3.4:int:56789, id-kp:str:name'File to save certTemplate received in genp of type certReqTemplateOptional file to save Key specification received in genp of type certReqTemplateCertificate enrollment options: Private or public key for the requested cert. Default: CSR key or client keyNew private key pass phrase sourceRequest central (server-side) key generation. Default is local generationFile to save centrally generated key, in PEM formatDistinguished Name (DN) of subject to use in the requested cert templateFor kur, default is subject of -csr arg or reference cert (see -oldcert)this default is used for ir and cr only if no Subject Alt Names are setRequested validity time of the new certificate in number of daysName of config file section defining certificate request extensions.Augments or replaces any extensions contained CSR given with -csrSubject Alt Names (IPADDR/DNS/URI) to add as (critical) cert req extensionDo not take default SANs from reference certificate (see -oldcert)Name of config file section defining policies certificate request extensionPolicy OID(s) to add as policies certificate request extensionFlag the policy OID(s) given with -policy_oids as criticalProof-of-Possession (POPO) method to use for ir/cr/kur where-1 = NONE, 0 = RAVERIFIED, 1 = SIGNATURE (default), 2 = KEYENCPKCS#10 CSR file in PEM or DER format to convert or to use in p10crCertificates to trust when verifying newly enrolled certificatesRequest implicit confirmation of newly enrolled certificatesDo not confirm newly enrolled certificate w/o requesting implicitconfirmation. WARNING: This leads to behavior violating RFC 4210File to save newly enrolled certificateFile to save the chain of newly enrolled certificateCertificate enrollment and revocation options: Certificate to be updated (defaulting to -cert) or to be revoked in rr;also used as reference (defaulting to -cert) for subject DN and SANs.Issuer is used as recipient unless -recipient, -srvcert, or -issuer givenDN of the issuer to place in the certificate template of ir/cr/kur/rr;also used as recipient if neither -recipient nor -srvcert are givenSerial number of certificate to be revoked in revocation request (rr)Reason code to include in revocation request (rr); possible values:0..6, 8..10 (see RFC5280, 5.3.1) or -1. Default -1 = none included[http[s]://]address[:port][/path] of CMP server. Default port 80 or 443.address may be a DNS name or an IP address; path can be overridden by -path[http[s]://]address[:port][/path] of HTTP(S) proxy to use; path is ignoredList of addresses of servers not to use HTTP(S) proxy forDefault from environment variable 'no_proxy', else 'NO_PROXY', else noneDN of CA. Default: subject of -srvcert, -issuer, issuer of -oldcert or -certHTTP path (aka CMP alias) at the CMP server. Default from -server, else "/"Persistent HTTP connections. 0: no, 1 (the default): request, 2: requireNumber of seconds allowed per CMP message round trip, or 0 for infiniteOverall time an enrollment incl. polling may take. Default 0 = infiniteServer authentication options: Certificates to use as trust anchors when verifying signed CMP responsesIntermediate CA certs for chain construction for CMP/TLS/enrolled certsServer cert to pin and trust directly when verifying signed CMP responsesDN of expected sender of responses. Defaults to subject of -srvcert, if anyIgnore CMP signer cert key usage, else 'digitalSignature' must be allowedAccept missing or invalid protection of regular error messages and negativecertificate responses (ip/cp/kup), revocation responses (rp), and PKIConfWARNING: This setting leads to behavior allowing violation of RFC 4210Do not keep certificates received in the extraCerts CMP message fieldFile to save the server cert used and validated for CMP response protectionFile to save extra certificates received in the extraCerts fieldFile to save CA certs received in caPubs field or genp with id-it-caCertsRoot CA certificate to request update for in genm of type rootCaCertFile to save NewWithNew cert received in genp of type rootCaKeyUpdateFile to save NewWithOld cert received in genp of type rootCaKeyUpdateFile to save OldWithNew cert received in genp of type rootCaKeyUpdatecertificate to request a CRL for in genm of type crlStatusListCRL to request update for in genm of type crlStatusListFile to save new CRL received in genp of type 'crls'Client authentication options: Reference value to use as senderKID in case no -cert is givenPrefer PBM (over signatures) for protecting msgs with given password sourceClient's CMP signer certificate; its public key must match the -key argumentThis also used as default reference for subject DN and SANs.Any further certs included are appended to the untrusted certsOptional certs to verify chain building for own CMP signer certCMP signer private key, not used when -secret givenClient private key (and cert and old cert) pass phrase sourceDigest to use in message protection and POPO signatures. Default "sha256"MAC algorithm to use in PBM-based message protection. Default "hmac-sha1"Certificates to append in extraCerts field of outgoing messages.This can be used as the default CMP signer cert chain to includeSend request messages without CMP-level protectionFormat (PEM or DER) to use when saving a certificate to a file. Default PEMFormat (PEM or DER) to use when saving a CRL to a file. Default DERFormat of the key input (ENGINE, other values ignored)Pass phrase source potentially needed for loading certificates of othersUse crypto engine with given identifier, possibly a hardware device.Engines may also be defined in OpenSSL config file engine section.Enable using TLS (also when other TLS options are not set)Client's TLS certificate. May include chain to be provided to TLS serverPrivate key for the client's TLS certificatePass phrase source for the client's private TLS key (and TLS cert)Extra certificates to provide to TLS server during TLS handshakeTrusted certificates to use for verifying the TLS server certificate;this implies hostname validationAddress to be checked (rather than -server) during TLS hostname validationClient-side debugging options: Do not interactively prompt for input when a password is required etc.Invoke the transaction the given positive number of times. Default 1Take sequence of CMP requests to send to server from file(s)Use fresh transactionID for CMP requests read from -reqinSave sequence of CMP requests created by the client to file(s)Save first CMP request created by the client to file and exitProcess sequence of CMP responses provided in file(s), skipping serverSave sequence of actually used CMP responses to file(s)Use internal mock server at API level, bypassing socket-based HTTPAct as HTTP-based mock server listening on given portmax number of messages handled by HTTP mock server. Default: 0 = unlimitedReference value to use as senderKID of server in case no -srv_cert is givenPassword source for server authentication with a pre-shared key (secret)Private key used by the server for signing messagesServer private key (and cert) pass phrase sourceTrusted certificates for client authenticationIntermediate certs that may be useful for verifying CMP protectionCertificate to be expected for rr and any oldCertID in kur messagesCertificate to be returned as mock enrollment resultPrivate key for the certificate to be returned as mock enrollment resultKey to be returned for central key pair generationResponse private key (and cert) pass phrase sourceCRL to be returned in genp of type crlsExtra certificates to be included in mock certification responsesCA certificates to be included in mock ip responseNew root CA certificate to include in genp of type rootCaKeyUpdateNewWithOld transition cert to include in genp of type rootCaKeyUpdateOldWithNew transition cert to include in genp of type rootCaKeyUpdateNumber of times the client must poll before receiving a certificateThe check_after value (time to wait) to include in poll responseGrant implicit confirmation of newly enrolled certificatePKIStatus to be included in server response. Possible values: 0..6A single failure info bit number to include in server response, 0..26Number representing failure bits to include in server response, 0..2^27 - 1Status string to be included in server responseForce server to reply with error messageSend response messages without CMP-level protectionIn case of negative responses, server shall send unprotected error messages,certificate responses (ip/cp/kup), and revocation responses (rp).WARNING: This setting leads to behavior violating RFC 4210Accept missing or invalid protection of requestsAccept unprotected error messages from clientAccept RAVERIFIED as proof-of-possession (POPO)adds policy to the acceptable policy setchain authentication security levelpermit unhandled critical extensionscheck leaf certificate revocationset policy variable require-explicit-policyset policy variable inhibit-any-policyset policy variable inhibit-policy-mappingdisable certificate compatibility work-aroundsprint policy processing diagnosticssearch trust store first (default)Suite B 128-bit mode allowing 192-bit algorithmsaccept chains anchored by intermediate trust-store CAsignore certificate validity timeallow the use of proxy certificatesError allocating CMS_contentinfo Error reading %s Content Info Invalid key (supplied twice) %s Invalid id (supplied twice) %s Invalid OID (supplied twice) %s Illegal -inkey without -signer No Signed Receipts Recipients Signed receipts only allowed with -sign Multiple signers or keys not allowed Incompatible options: CAdES requires signed attributes Incompatible options: CAdES validation requires certs and signed attributes validations No signer certificate specified No recipient certificate or key specified No recipient(s) certificate(s) specified No operation option (-encrypt|-decrypt|-sign|-verify|...) specified. Warning: -nodetach option is ignored for non-signing operation Warning: -contfile option is ignored for the given operation Warning: recipient certificate file parameters ignored for operation other than -encrypt receipt signer certificate fileCannot use -digest for non-signing operation Cannot use -digest when -in, -nodetach or streaming is used Invalid hex value after -digest Cannot use originator for encryption Signed Receipt Request Creation Error Error decrypting CMS using secret key Error decrypting CMS using private key Error decrypting CMS using password Error decrypting CMS structure Receipt Request Parse Error Bad output format for CMS file Usage: %s [options] [cert...] Load a configuration file (this may load modules)Generate a signed receipt for a messageVerify receipts; exit if receipt signatures do not verifySign a pre-computed digest in hex notationCreate a CMS "DigestedData" objectVerify a CMS "DigestedData" object and output itCreate a CMS "CompressedData" objectUncompress a CMS "CompressedData" objectCreate CMS "EncryptedData" object using symmetric keyDecrypt CMS "EncryptedData" object using symmetric keyCopy CMS "Data" object to outputInput format SMIME (default), PEM or DEROutput format SMIME (default), PEM or DERTreat input as binary: do not translate to canonical formUse CRLF as EOL termination instead of LF onlyPerform CRLF canonicalisation when signingSpecific password for recipientUse specified hex-encoded key to decrypt/encrypt recipients or contentIdentity of the -secretkey for CMS "KEKRecipientInfo" objectInput private key (if not signer or recipient)Set public key parameters as n:v pairsInput private key format (ENGINE, other values ignored)Use engine e, possibly a hardware deviceEncryption and decryption options: Recipient certs (optional; used only when encrypting)The encryption algorithm to use (any supported cipher)Key wrap algorithm to use when encrypting with key agreementDisable MMA protection, return error if no recipient found (see doc)Extra signer and intermediate CA certificates to include when signingor to use as preferred signer certs and for chain building when verifyingInclude signingCertificate attribute (CAdES-BES)Don't include signer's certificate when signingDon't include any signed attributesOmit the SMIMECapabilities attributeOmit the signing time attributeWhen signing, create a receipt request for all recipientsWhen signing, create a receipt request for first recipientCreate signed receipt request with specified email addressCreate signed receipt targeted to specified addressSigner certificate(s) output fileSupply or override content for detached signatureDo not verify signed content signaturesDo not verify signed attribute signaturesDon't verify message signatureDon't verify signers certificateDon't search certificates in message for signerCheck signingCertificate (CAdES-BES)Exit non-zero on verification failureTrusted certificates directoryTrusted certificates store URIDo not load the default certificates fileDo not load certificates from the default certificates directoryDo not load certificates from the default certificates storeInclude or delete text MIME headersFor the -cmsout operation do not output the parsed CMS structureFor the -cmsout operation print out all fields of the CMS structureFor the -print option specifies various strings printing optionsError initialising X509 store Error getting CRL issuer certificate Error getting CRL issuer public key CRL input format (DER or PEM); has no effectCRL signing Private key to usePrivate key file format (DER/PEM/P12); has no effectPrint out a text format versionPrint old-style (MD5) hash valueCertificate subject/issuer name printing optionsCorrupt last byte of loaded CRL signature (for test)Other CRL to compare/diff to the Input oneVerify CRL using certificates in dirVerify CRL using certificates in file nameVerify CRL using certificates in store URINo crl to load, just certs from '-certfile'File of chain of certs to a trusted CA; can be repeatedError getting maximum length of signed data key must be set for one-shot algorithms %s: Can only sign or verify one file. No signature to verify: use the -signature option MAC and signing key cannot both be specified Signature parameter error "%s" Error opening signature file %s Error reading signature file %s Length can only be specified for XOF Signing key cannot be specified for XOF Usage: %s [options] [file...] Also use engine given by -engine for digest operationsPrint the digest with separating colonsPrint the digest in coreutils formatOutput to filename rather than stdoutKey file format (ENGINE, other values ignored)Output length for XOF algorithms. To obtain the maximum security strength set this to 32 (or greater) for SHAKE128, and 64 (or greater) for SHAKE256Verify a signature using public keyVerify a signature using private keyCreate MAC (not necessarily HMAC)MAC algorithm parameters in n:v form or keyCompute HMAC with the key used in OpenSSL-FIPS fingerprintFiles to digest (optional; default is stdin)Error, failed to set DH parameters Error, generator may not be chosen for DSA parameters Warning, input file %s ignored Error, %s param generation context allocation failed Generating %s parameters, %d bit long %sprime Error, unable to initialise %s parameters Error, unable to set DSA prime length Error, unable to set DH prime length Error, unable to set generator Error, unable to load parameters Error, unable to load DSA parameters Error, unable to load DH parameters Error, failed to check DH parameters Error, invalid parameters generated DH parameters appear to be ok. Error, unable to write DH parameters Usage: %s [options] [numbits] Read or generate DSA parameters, convert to DHPrint a text form of the DH parametersDon't output any DH parametersGenerate parameters using 2 as the generator valueGenerate parameters using 3 as the generator valueGenerate parameters using 5 as the generator valueNumber of bits if generating parameters (optional)PVK form impossible with public key input bad output format specified for outfile Enable 'Strong' PVK encoding level (default)Enable 'Weak' PVK encoding levelInput format (DER/PEM/PVK); has no effectExpect a public key in input fileOutput public key, not privateOutput file pass phrase sourceError, DSA parameter generation context allocation failed Warning: It is not recommended to use more than %d bit for DSA keys. Your key size is %d! Larger key size may behave not as expected. Generating DSA parameters, %d bit long prime Error, DSA key generation paramgen init failed Error, DSA key generation setting bit length failed Error, DSA key generation setting subprime bit length failed Error, unable to write DSA parameters Error, DSA key generation context allocation failed Error, unable to initialise for key generation Usage: %s [options] [numbits] [numqbits] Number of bits if generating parameters or key (optional)Number of bits in the subprime parameter q if generating parameters or key (optional)unable to set point conversion format unable to set asn1 encoding format unable to disable public key encoding unable to enable public key encoding Input format (DER/PEM/P12/ENGINE)Specifies the way the ec parameters are encodedSpecifies the point conversion form Print the elliptic curve parametersexclude public key from private keyCURVE DESCRIPTION NOT AVAILABLEusing curve name prime192v1 instead of secp192r1 using curve name prime256v1 instead of secp256r1 Unable to load parameters from %s checking elliptic curve parameters: unable to write elliptic curve parameters Prints a list of all curve 'short names'Input format - default PEM (DER or PEM)Print the ec parameters in text formCheck that named EC curve parameters have not been modifiedIf 'explicit' parameters are chosen do not use the seedUse the ec parameters with specified 'short name'hex string is too long, ignoring excess hex string is too short, padding with zero bytes to length *** WARNING : deprecated key derivation used. Using -iter or -pbkdf2 would be better. warning: iv not used by this cipher Either a raw key or the 'skeyopt' args must be used. Error creating opaque key object for skeymgmt %s Error setting an opaque key for cipher %s Base64 encode/decode, depending on encryption flagUsed with -[base64|a] to specify base64 buffer as a single lineDisable standard block paddingUse specified digest to create a key from the passphraseSpecify the iteration count and force the use of PBKDF2Use password-based key derivation function 2 (PBKDF2)Use -iter to change the iteration count from 10000Specify the PBKDF2 salt length (in bytes)Compress or decompress encrypted data using zlibKey options as opt:value for opaque symmetric key handlingSymmetric key management name for opaque symmetric key handling[Error]: internal stack error [Error]: command name too long %s: Cannot mix flags and engine names. Usage: %s [options] engine... Check that specified engine is availableRun command against the ENGINE before loading itRun command against the ENGINE after loading itList 'control commands' For each specified engineAlso display each command's descriptionAlso add the input flags for each commandAlso show internal input flagsList the capabilities of specified engineDisplay error trace for unavailable enginesCommands are like "SO_PATH:/lib/libdriver.so"Usage: %s [options] errnum... Cannot specify -%s after -pedantic Missing -in option for -verify hexkey:f4556650ac31d35461610bac4ed81b1a181b2d8a43ea2854cbae22ca74560813Unable to create MAC CTX for module check Unable to create MAC CTX for install indicator Module integrity MAC not found Install indicator MAC not found Install indicator status mismatch providers = provider_section Failed to query FIPS module parameters Set options for strict FIPS complianceVerify a config file instead of generating oneFile name of the provider moduleFIPS Provider config section name (optional)Disable the ability of the fips module to enter an error state if any conditional self tests failDisable the run-time FIPS security checks in the moduleForces self tests to always run on module loadForces self tests to run once on module installationEnable the run-time FIPS check for EMS during TLS1_PRFDisallow truncated digests with Hash and HMAC DRBGsEnable checking for approved digests for signaturesEnable digest check for TLS13-KDFEnable digest check for TLS1-PRFEnable digest check for SSHKDFEnable digest check for X963KDFDisallow Triple-DES encryptionDisallow PKCS#1 version 1.5 padding for RSA encryptionEnable salt length check for RSA-PSS signature operationsDisallow X931 Padding for RSA signingEnable key check for TLS13-KDFDisable lower bound check for PBKDF2Enable Cofactor check for ECDHInput config file, used when verifyingOutput config file, used when generatingMAC algorithm parameters in n:v form.See 'PARAMETER NAMES' in the EVP_MAC_ docsDisable logging of self test eventsCorrupt a self test by descriptionunable to create PKEY context unable to set up for key generation unable to output generated key Usage: %s [options] dsaparam-file Output the key to the specified fileEncrypt the output with any supported cipherFile containing DSA parametersError initializing %s context The possible -pkeyopt arguments are: Error reading parameter file %s %s: Error setting %s parameter: Cannot use cipher with -genparam option Error writing to outpubkey: '%s'. Error: %s Error writing to outfile: '%s'. Error: %s Output status while generating keysDo not output status while generating keysSet the public key algorithm option as opt:valueCipher to use to encrypt the keyOrder of options may be important! See the documentation. Warning: It is not recommended to use more than %d bit for RSA keys. Your key size is %d! Larger key size may behave not as expected. Error allocating RSA public exponent Error setting RSA public exponent Error setting number of primes (deprecated) Use 3 for the E valueUse the Fermat number F4 (0x10001) for the E valueOutput the key to specified fileUse traditional format for private keysDefault configuration file directoryDefault engine module directoryDefault module directory (other than engine modules)Configured extension for modulesKDF algorithm control parameters in n:v formSee 'Supported Controls' in the EVP_KDF_ docs The size of the output derived keyOutput in binary format (default is hexadecimal)retrievable algorithm parametersretrievable operation parameterssettable key generation parametersInvalid command '%s'; type "help" for a list. Provided Asymmetric Encryption: Provided RNGs and seed sources: ERROR: could not list all provider signature algorithms No TLS sig algs registered by currently active providersERROR: setting TLS protocol version ERROR: getting implemented TLS group list WARNING: Unable to query provider parameters for %s List of message digest commands (deprecated)List of message digest algorithmsList of key derivation and pseudo random function algorithmsList the primary, public and private random number generator detailsList of random number generatorsList of message authentication code algorithmsList of cipher commands (deprecated)List of symmetric cipher algorithmsList of symmetric key managersList of key exchange algorithmsList of key encapsulation mechanism algorithmsList of TLS signature algorithmsList of asymmetric cipher algorithmsList implemented TLS key exchange 'groups'List implemented TLS key exchange 'groups' and all aliasesWhen listing 'groups', list those compatible with TLS1.2When listing 'groups', list those compatible with TLS1.3List options for specified commandList built in objects (OID<->name mappings)MAC algorithm parameters in n:v formInput file to MAC (default is stdin)%s: Error reading certs file %s %s: Error reading sequence file %s Error querying OCSP responder %s Error parsing -url argument No issuer certificate specified Error converting serial number %s Missing = in header key=value %s: Digest must be before -cert or -serial Error loading responder certificate Responder mode requires certificate, key, and CA. waiting for OCSP client connections...error reloading updated index: %sNeed an OCSP request for this operation! Error loading signer certificate WARNING: no nonce in response WARNING: Status times invalid. Ignore error on OCSP request or response and continue runningConnection timeout (in seconds) to the OCSP responderDon't include any certificates in responserun multiple responder processesDon't include any certificates in signed requestCorrupt last byte of loaded OCSP response signature (for test)Number of minutes before next updateNumber of requests to accept (default unlimited)File with the DER-encoded requestCertificate to sign OCSP request withAdditional certificates to include in signed requestNumber of days before next updateResponder certificate to sign responses withResponder key to sign responses withResponder key pass phrase sourceOther certificates to include in responseDigest Algorithm to use in signature of OCSP responseOCSP response signature parameter in n:v formUse specified algorithm for cert id in responseAny supported digest algorithm (sha1,sha256, ... )TCP/IP hostname:port to connect to[http[s]://]host[:port][/path] of HTTP(S) proxy to use; path is ignoredDon't add OCSP nonce to requestDon't check signature on responseIdentify response by signing certificate key IDDon't check signing certificatePrint text form of request and responseDon't do additional checks on signing certificateDo not explicitly check the chain, just verify the rootDon't verify additional certificatesDon't search certificates contained in response for signerFile with the DER-encoded responseAdditional certificates to search for signerCertificate to check; may be given multiple timesSerial number to check; may be given multiple timesMaximum validity discrepancy in secondsPrivate key to sign OCSP request withOutput file for the DER-encoded requestOutput file for the DER-encoded responseThe command %s was deprecated in version %s.FATAL: Startup failure (dev note: %s()) for %s %s: could not get default config file Message Digest commands (see the `dgst' command for more details) Cipher commands (see the `enc' command for more details) Usage: help [options] [command] Name of command to display help (optional)Warning: truncating password to %u characters %s: Can't combine -in and -stdin Usage: %s [options] [password] Never verify when reading password from terminalSHA512-based password algorithmSHA256-based password algorithmMD5-based password algorithm, Apache variantAIX MD5-based password algorithmPassword text to digest (optional), Salt length: %d, Cost(N): %ld, Block size(r): %ld, Parallelism(p): %ldWarning unsupported bag type: Warning: -%s option ignored with -export Warning: output encryption option -%s ignored with -export Warning: -%s option ignored without -export Error getting certificate file password Option -twopass cannot be used with -passout or -password Option -twopass cannot be used with -passin or -password Nothing to export due to -noout or -nocerts and -nokeys Warning: -chain option ignored with -nocerts No certificate in -in file %s No cert in -in file '%s' matches private key No end entity certificate to check with -chain extra certificates from -certfileError creating PKCS12 structure for %s Error creating PKCS12 MAC; no PKCS12KDF support? Use -nomac or -pbmac1_pbkdf2 if PKCS12KDF support not available , Unsupported KDF or params for PBMAC1 Key length: %ld, Salt length: %d MAC length: %ld, salt length: %ld Error verifying PKCS12 MAC; no PKCS12KDF support. Use -nomacver if MAC verification is not required. Mac verify error: invalid password? Warning: using broken algorithm Error outputting keys and certificates Set PKCS#12 import/export password sourceSeparate MAC, encryption passwordsDon't output anything, just verify PKCS#12 inputUse legacy encryption: 3DES_CBC for keys, RC2_CBC for certsPKCS#12 import (parsing PKCS#12) options: Print info about PKCS#12 structureOnly output client certificatesAny supported cipher for output encryptionDon't encrypt private keys; deprecatedPKCS#12 output (export) options: Private key, else read from -in input fileExtra certificates for PKCS12 outputCertificate file pass phrase sourceBuild and add certificate chain for EE cert,which is the 1st cert from -in matching the private key (if given)Untrusted certificates for chain buildingUse name as CA friendly name (can be repeated)Add local machine keyset attribute to private keySet key type to MS key exchangeSet key type to MS key signaturePrivate key PBE algorithm (default AES-256 CBC)Certificate PBE algorithm (default PBES2 with PBKDF2 and AES-256 CBC)Encrypt output with 3DES (default PBES2 with PBKDF2 and AES-256 CBC)Digest algorithm to use in MAC (default SHA256)Use PBMAC1 with PBKDF2 instead of MACDigest to use for PBMAC1 KDF (default SHA256)Specify the iteration count for encryption and MACDon't use encryption iterationUnused, kept for backwards compatibilityMark certificate in PKCS#12 store as trusted for JDK compatibilityunable to allocate PKCS7 object Print full details of certificatesPrint out all fields of the PKCS7 structurePrint_certs print any certs or crl in the inputWhen used with -print_certs, it produces a cleaner outputSet the PRF algorithm to use with PKCS#5 v2.0Use or expect unencrypted private keyuse traditional format private keySpecify the salt length (in bytes)Default: 8 (For PBE1) or 16 (for PBE2)Warning: The -text option is ignored with -text_pub Warning: The -traditional is ignored since there is no PEM output Warning: The -passout option is ignored without a cipher option Error: Cipher options are supported only for PEM output Error: Text output cannot be combined with DER output Key input format (ENGINE, other values ignored)Read only public components from key inputOutput file for encoded and/or text outputOutput encoding format (DER or PEM)Any supported cipher to be used for encryptionOutput PEM file pass phrase sourceUse traditional format for private key PEM outputRestrict encoded output to public componentsDo not output the key in encoded formOutput key components in plaintextOutput only public key components in text formSpecifies the EC point conversion form in the encodingSpecifies the way the EC parameters are encodedDon't output encoded parameters%s: no KDF length given (-kdflen parameter). %s: no private key given (-inkey parameter). %s: -peerkey option not allowed without -derive. %s: missing -peerkey option for -derive operation. A private key is needed for this operation %s: -verifyrecover can be used only with RSA %s: -rev cannot be used with raw input %s: -digest (prehash) is not supported with %s %s: -digest and -rawin can only be used with -sign or -verify The given KDF "%s" is unknown. %s: Error initializing context Type of peer public key: %s does not match type of private key: %s %s: Error setting up peer key %s: Can't set parameter "%s": %s: Signature file specified for non verify %s: No signature file specified for verify %s: Decapsulation produces only a shared secret and no output. The '-out' option is not applicable. KEM-based shared-secret derivation requires the '-secret ' option Error: The non-raw input data length %d is too long - max supported hashed size is %d Error: unable to determine file size for oneshot operation Error verifying raw input data Signature Verified Successfully Signature Verification Failure Also use engine given by -engine for crypto operationsSign input data with private keyEncrypt input data with public keyDecrypt input data with private keyDerive shared secret from own and peer (EC)DH keysInput key, by default private keyPeer key file used in key derivationPeer key format (DER/PEM/P12/ENGINE)Input is a cert with a public keyReverse the order of the input bufferSignature file (verify operation only)Private key format (ENGINE, other values ignored)File to store secret on encapsulationparse the output as ASN.1 data to check its DER encoding and print errorsVerify RSA signature, recovering original signature input dataSigning/Derivation/Encapsulation options: Indicate that the signature/verification input data is not yet hashedThe digest algorithm to use for signing/verifying raw input data. Implies -rawinPublic key options as opt:valuePublic key option that is read as a passphrase argument opt:passphraseKEM operation specific to the key algorithmUsage: %s [options] [number...] When used with -generate, generate a safe primeNumber(s) to check for primality if not generating%lu bytes with suffix overflows Request exceeds max allowed output Usage: %s [options] num[K|M|G|T] %s: warning: skipping duplicate %s in %s %s: error: hash table overflow for %s %s: error: skipping %s, cannot open file %s: warning: skipping %s, it does not contain exactly one certificate or CRL %s: error calculating SHA1 hash value Usage: %s [options] [directory...] Create both new- and old-style hash linksUse old-style hash to generate linksOne or more directories to process (optional)Missing newline at end of input String too short, must be at least %d bytes long String too long, must be at most %d bytes long issuer private key from -CAkey argissuer private key from -CA arg%s: -days parameter arg must be >= -1 Parse error on -addext: missing '=' Parse error on -addext: missing key Internal error handling -addext %s Warning: Ignoring -days without -x509; not generating a certificate Warning: Ignoring -not_before without -x509; not generating a certificate Warning: Ignoring -not_after without -x509; not generating a certificate Warning: Ignoring -copy_extensions 'none' when -x509 is not given Warning: Will read cert request from stdin since no -in option is given Using additional configuration from -addext options Problems opening '%s' for extra OIDs Error checking %s extension section %s Error checking extensions defined using -addext Warning: Not generating key via given -newkey option since -key is given Parameter file requested but no path given: %s Cannot open parameter file %s Key type does not match parameters Error allocating keygen context Error initializing keygen context Private key length too short, needs to be at least %d bits, not %ld. Warning: It is not recommended to use more than %d bit for RSA keys. Your key size is %ld! Larger key size may behave not as expected. Warning: It is not recommended to use more than %d bit for DSA keys. Your key size is %ld! Larger key size may behave not as expected. Warning: Not placing -key in cert or request since request is used Warning: Ignoring -in option since -new or -newkey or -precert is given Warning: Ignoring -CAkey option since no -CA option is given Issuer CA certificate and key do not match Must provide a signature key using -key or provide -CA / -CAkey Error: No objects specified in config file You are about to be asked to enter information that will be incorporated into your certificate request. What you are about to enter is what is called a Distinguished Name or a DN. There are quite a few fields but you can leave some blank For some fields there will be a default value, If you enter '.', the field will be left blank. Please enter the following 'extra' attributes to be sent with your certificate request No template, please set one up. Error making certificate request Warning: Not using -key or -newkey for signing since -CA option is given Warning: -not_after option overriding -days option Warning: No -copy_extensions given; ignoring any extensions in the request Error copying extensions from request Error adding x509 extensions from section %s Error adding x509 extensions defined via -addext Error adding poison extension Warning: Ignoring -precert flag since no cert is produced Error adding request extensions from section %s Error adding request extensions defined via -addext Modifying subject of certificate request Error modifying subject of certificate request Certificate request self-signature verify failure Certificate request self-signature verify OK Error printing certificate request Unable to write certificate request Unable to write X509 certificate Specify the cipher for private key encryptionSpecify engine to be used for key generation operationsX.509 request input file (default stdin)Verify self-signature on the requestConfig section to use (default "req")Input characters are UTF8 (default ASCII)Output an X.509 certificate structure instead of a cert requestRequest cert generation with X.509 version 1Issuer cert to use for signing a cert, implies -x509Issuer private key to use with -CA; default is -CA argSet or modify subject of request or certPrint the subject of the output request or certNumber of days certificate is valid forcopy extensions from request when using -x509Cert or request extension section (override value in config file)Additional cert extension key=value pair (may be given more than once)Add a poison extension to generated cert (implies -new)Key for signing, and to include unless -in givenPrivate key and certificate password sourceGenerate new key with [:] or [:] or param:Do not ask anything during request generationOutput "NEW" in the header linesOnly private keys can be checked RSA unable to create PKEY context Output format, one of DER PEM PVKInput key, by default an RSA private keyInput key is an RSA public pkeyInput is a cert carrying an RSA public keyUse PKCS#1 v1.5 padding (default)Run output through asn1parse; useful with -verify ====================================== ====================================== Error writing session file %s --- Post-Handshake New Session Ticket arrived: Protocols advertised by server: NULL received PSK identity hint, continuing anyway Received PSK identity hint '%s' Could not convert PSK key '%s' to buffer psk buffer of callback is too small (%d) for key (%ld) Error finding suitable ciphersuite %s: warning: bad TLSA %s field in: %s %s: warning: unusable TLSA rrdata: %s %s: warning: error loading TLSA rrdata: %s Enter text to send to the peer followed by To issue a command insert {cmd} or {cmd:arg} anywhere in the text Entering {{ will send { to the peer The following commands are available {quit}: Close the connection to the peer {reconnect}: Reconnect to the peer {fin}: Send FIN on the stream. No further writing is possible {keyup:req|noreq}: Send a Key Update message Arguments: req = peer update requested (default) noreq = peer update not requested {reneg}: Attempt to renegotiate a:PKEY: %s, (%s); sigalg: %s a:PKEY: %s, %d (bit); sigalg: %s no peer certificate available Client-to-server raw public key negotiated Server-to-client raw public key negotiated --- SSL handshake has read %ju bytes and written %ju bytes Using Kernel TLS for receiving SRTP Extension negotiated, profile=%s ERROR PROCESSING COMMAND. REST OF LINE IGNORED: %s UNRECOGNISED COMMAND (IGNORED): %s BAD ARGUMENT (COMMAND IGNORED): %s %s: Intermixed protocol flags (unix and internet domains) %s: Intermixed protocol flags (internet and unix domains) Cannot supply multiple protocol flags Cannot supply both a protocol flag and '-no_' Error getting client auth engine SRP minimal length for N is %d %s: Max Fragment Len %u is out of permitted values%s: cannot provide both -connect option and target parameter %s: Can't use -servername and -noservername together %s: Can't use -dane_tlsa_domain and -noservername together Cannot supply -nextprotoneg with TLSv1.3 %s: -connect argument or target parameter malformed or ambiguous %s: -proxy requires use of -connect or target parameter %s: -proxy argument malformed or ambiguous %s: -bind argument parameter malformed or ambiguous Can't use unix sockets and datagrams together Error parsing -nextprotoneg argument Error getting private key password Error: Must specify proxy_user with proxy_pass client certificate private keyError using configuration "%s" %s: Max send fragment size %u is out of permitted range %s: Split send fragment size %u is out of permitted range %s: Max pipelines %u is out of permitted range %s: Max Fragment Length code %u is out of permitted values Error loading store locations Error setting client auth engine PSK key given, setting client callback Can't open PSK session file %s Can't read PSK session file %s Warning: Unable to add custom extension %u, skipping %s: Error enabling DANE TLSA authentication. Error setting client certificate types Error setting server certificate types Unable to set TLS servername extension. %s: DANE TLSA authentication requires at least one -dane_tlsa_rrdata option. %s: Failed to import any TLSA records. %s: DANE TLSA authentication requires the -dane_tlsa_domain option. %s: DTLS does not support the -tfo option %s: QUIC does not support the -tfo option %s: QUIC requires ALPN to be specified (e.g. "h3" for HTTP/3) via the -alpn option MTU too small. Must be at least %ld Failed to set the initial peer address Didn't find STARTTLS in server response, trying anyway... Timeout waiting for response (%d seconds). Server does not support STARTTLS. MySQL packet length does not match. Only MySQL protocol version 10 is supported. Cannot confirm server version. MySQL server handshake packet is broken. MySQL server does not support SSL. ldap_ExtendedResponse_parse failed STARTTLS failed, LDAP Result Code: %i drop connection and then reconnect Usage: %s [options] [host:port] Specify engine to be used for client certificate operationsUse specified section for SSL_CTX configurationRequest and parse SCTs (also enables OCSP stapling)Do not request or parse SCTs (default)TCP/IP where to connect; default: 4433)bind local address for connectionConnect to via specified proxy to the real serverUserID for proxy authenticationProxy authentication password sourceConnect over the specified Unix-domain socketEnable Maximum Fragment Length Negotiation (len values: 512, 1024, 2048 and 4096)Size used to split data for encrypt pipelinesMaximum number of encrypt/decrypt pipelines to be usedDefault read buffer size to be used for connectionsClient certificate file to useClient certificate file format (PEM/DER/P12); has no effectClient certificate chain file (in PEM format)Build client certificate chainPrivate key file to use; default: -cert fileKey format (ENGINE, other values ignored)Private key and cert file pass phrase sourceTurn on peer certificate verificationPEM format file of CA names to send to the serverDANE TLSA rrdata presentation formDisable name checks when matching DANE-EE(3) TLSA recordsFile to read PSK SSL session fromHostname to use for "-starttls lmtp", "-starttls smtp" or "-starttls xmpp[-server]"Drop and re-make the connection with the same Session-IDConvert LF from terminal into CRLFIgnore input eof (default when -quiet)Use the appropriate STARTTLS command before starting TLSAlias of -name option for "-starttls xmpp[-server]"Restrict output to brief summary of connection parametersPrint session information when the program exitsDon't run the client in the interactive modeShow all certificates sent by the serverFile to send output of -msg or -trace, instead of stdoutExport keying material using labelExport len bytes of keying material; default 20Enable security debug messagesOutput more security debug outputShow trace output of protocol messagesDo not use interactive command lettersSet TLS extension servername (SNI) in ClientHello (default)Do not send the server name (SNI) extension in the ClientHelloHex dump of all TLS extensions receivedDo not treat lack of close_notify from a peer as an errorRequest certificate status from servertypes Send empty ClientHello extensions (comma-separated numbers)Enable ALPN extension, considering named protocols supported (comma-separated list)Support asynchronous operationProtocol and version options: Enable send/receive timeout on DTLS connectionsEnable NPN extension, considering named protocols supported (comma-separated list)Enable post-handshake-authenticationEnable raw public keys (RFC7250) from the serverEnable raw public keys (RFC7250) from the clientOffer SRTP key management with a colon-separated profile list(deprecated) SRP authentication for 'user'(deprecated) Password for 'user'(deprecated) SRP username into second ClientHello message(deprecated) Tolerate other than the known g N values.(deprecated) Minimal length in bits for NEnable Kernel TLS for sending and receivingDisable SSL/TLS compression (default)Disable sending TLSv1.3 compressed certificatesDisable receiving TLSv1.3 compressed certificatesDisable use of TLS session ticketsUse server's cipher preferencesEnable use of legacy renegotiation (dangerous)Allow client-initiated renegotiationAllow initial connection to servers that don't support RIDisallow session resumption on renegotiationDisallow initial connection to servers that don't support RIIn TLSv1.3 allow non-(ec)dhe based key exchange on resumptionIn TLSv1.3 prefer non-(ec)dhe over (ec)dhe-based key exchange on resumptionPrioritize ChaCha ciphers when preferred by clientsEnforce strict certificate checks as per TLS standardSignature algorithms to support (colon-separated list)Signature algorithms to support for client certificate authentication (colon-separated list)Groups to advertise (colon-separated list)Elliptic curve used for ECDHE (server-side only)Specify TLSv1.2 and below cipher list to be usedSpecify TLSv1.3 ciphersuites to be usedSpecify the minimum protocol version to be usedSpecify the maximum protocol version to be usedBlock size to pad TLS 1.3 records to.Perform all sorts of protocol violations for testing purposesDisable TLSv1.3 middlebox compat modeDisable Encrypt-then-Mac extensionDisable Extended master secret extensionDownload CRL from distribution pointsCRL format (PEM or DER); default PEMClose connection on verification errorRestrict verify output to errorsCA file for certificate chain (PEM format)Use dir as certificate store path to build CA certificate chainCA store URI for certificate chainCA file for certificate verification (PEM format)Use dir as certificate store path to verify CA certificateCA store URI for certificate verificationExtended certificate options: cert for Extended certificateschain for Extended certificatesbuild certificate chain for the extended certificatesformat of Extended certificate (PEM/DER/P12); has no effectformat of Extended certificate's key (DER/PEM/P12); has no effectWhere to connect; same as -connect option%4ld items in the session cache %4ld client connects (SSL_connect()) %4ld client renegotiates (SSL_connect()) %4ld client connects that finished %4ld server accepts (SSL_accept()) %4ld server renegotiates (SSL_accept()) %4ld server accepts that finished %4ld cache full overflows (%ld allowed) Error waiting for client response HTTP/1.0 200 ok Content-type: text/html Ciphers supported in s_server binary --- Ciphers common between both SSL end points: no client certificate available HTTP/1.0 200 ok Content-type: text/plain '%s' is an invalid file name Error opening '%s' mode='%s' Warning: sendfile requested but KTLS is not available Error: client did not send PSK identity PSK warning: client identity not what we expected (got '%s' expected '%s') ALPN protocols advertised by the client: Out of memory adding to external cache Unexpected session encoding length New session added to external cache cert_status: Cannot open OCSP response file cert_status: Error reading OCSP response cert_status: can't parse AIA URL cert_status: no AIA and no default responder URL cert_status: Can't retrieve issuer certificate. cert_status: error querying responder cert_status: ocsp response sent: Error setting session id context Error clearing SSL connection %s: -port argument malformed or ambiguous %s: -accept argument malformed or ambiguous verify depth is %d, must return a certificate Error parsing -status_url argument Invalid value for max_early_data Invalid value for recv_max_early_data Can't use -HTTP, -www or -WWW with DTLS Can only use -listen with DTLS Can only use --stateless with TLS Can't use -early_data in combination with -rev Warning: -zerocopy_sendfile depends on -sendfile, enabling -sendfile now. Warning: -sendfile depends on -ktls, enabling -ktls now. Can't use -sendfile without -WWW or -HTTP server certificate private keysecond server certificate private keysecond certificate private keysecond server certificate chainwarning: id_prefix is too long, only one new session will be possible Setting secondary ctx parameters Using default temp DH parameters Error setting temp DH parameters PSK key given, setting server callback PSK warning: there is NO identity hint in TLSv1.3 error setting PSK identity hint to context error setting session id context Error compressing certs on ctx Error compressing certs on ctx2 Configure SSL_CTX using the given configuration valueTCP/IP port to listen on for connections (default is 4433)TCP/IP optional host and port to listen on for connections (default is *:4433)Unix domain socket to accept onFor -unix, unlink existing socket firstListen for TCP Fast Open connectionsDo not load certificates from the default certificates store URIDon't use any certificates (Anon-DH)Turn on peer certificate verification, must have a certServer certificate file to use; default server.pemCertificate file to use for servername; default server2.pemServer certificate file format (PEM/DER/P12); has no effectServer certificate chain file in PEM formatBuild server certificate chainPEM serverinfo file for certificatePrivate key file to use; default is -cert file or elseserver.pem-Private Key file to use for servername if not in -cert2Second server certificate file to use (usually for DSA)Second server certificate file format (PEM/DER/P12); has no effectsecond server certificate chain file in PEM formatSecond private key file to use (usually for DSA)Second key file format (ENGINE, other values ignored)Second private key and cert file pass phrase sourceServername for HostName TLS extensionOn servername mismatch send fatal alert (default warning alert)Test with the non-blocking test bioDisable caching and tickets if ephemeral (EC)DH is usedRespond to a 'GET /' with a status pageRespond to a 'GET with the file ./pathLike -WWW but ./path includes HTTP headersGenerate SSL/TLS session IDs prefixed by argCRL file format (PEM or DER); default PEMDownload CRLs from distribution points in certificate CDP entriesuse dir as certificate store path to build CA certificate chainuse URI as certificate store to build CA certificate chainuse dir as certificate store path to verify CA certificateuse URI as certificate store to verify CA certificateDisable internal cache, set up and use external cacheNo verify output except verify errorsIgnore input EOF (default when -quiet)Pre-compress server certificatesPrint more output in certificate status callbackStatus request responder timeoutFile containing DER encoded OCSP ResponsePrint output from SSL/TLS security frameworkPrint more output from SSL/TLS security frameworkact as an echo server that sends back received text reversedTerminate after #num connections(deprecated) The verifier file for SRP(deprecated) A seed string for a default user saltThe maximum number of bytes of early data as advertised in ticketsThe maximum number of bytes of early data (hard limit)The number of TLSv1.3 session tickets that a server will automatically issueSwitch on anti-replay protection (default)Switch off anti-replay protectionopening files in binary mode when acting as http server (-WWW and -HTTP)Disable TLS Extension CA NamesListen for a DTLS ClientHello with a cookie and then connectSet the advertised protocols for the NPN extension (comma-separated list)Set the advertised protocols for the ALPN extension (comma-separated list)Use sendfile to response file with -WWWUse zerocopy mode of KTLS sendfile Now timing with session id reuse.Collecting connection statistics for %d seconds %d connections in %.2fs; %.2f connections/user sec, bytes read %ld %d connections in %ld real seconds, %ld bytes read per connection 0 connections in %ld real seconds Where to connect as post:port (default is localhost:4433)Turn on peer certificate verification, set depthSeconds to collect data, default 30Fetch specified page from the siteCert file to use, PEM format assumedFile with key, PEM; default is -cert fileOutput format - default PEM (PEM, DER or NSS)Don't output the encoded session infoEither -skeymgmt -or -cipher option should be specified Error creating opaque key for skeymgmt %s An opaque key identified by %s is created Key generation is the only supported operation as of now Key options as opt:value for opaque keys handlingSymmetric key management name for opaque keys handlingGenerate an opaque symmetric keyThe cipher to generate key for%s: Cannot use -%s together with -%s %s: Must have -signer before -inkey No operation (-encrypt|-sign|...) specified Error allocating PKCS7 object Bad input format for PKCS#7 file Error creating PKCS#7 structure Error decrypting PKCS#7 structure Bad output format for PKCS#7 file Digest algorithm to use when signing or resigningDon't translate message to textDon't include signers certificate when signingVerification/Decryption options: Recipient certificate file for decryptionset PKCS7_NOCHAIN so certificates contained in the message are not used as untrusted CAsRecipient certs, used when encryptingSIG verify failure at count %d Couldn't set input text length Couldn't insert AAD when encrypting Couldn't set cipher text length Couldn't insert AAD when decrypting Requested encryption length not a multiple of block size for %s! Doing %s ops for %ds on %d size blocks: Doing %u bits %s %s ops for %ds: WARNING: the error queue contains previous unhandled errors. Unhandled error in the error queue during EC key setup. Too many fds in ASYNC_WAIT_CTX Error: max_fd (%d) must be smaller than FD_SETSIZE (%d). Decrease the value of async_jobs Don't understand line '%s' from child %d Unknown type '%s' from child %d Waitng for child failed with 0x%x Child terminated by signal %d failed to allocate cipher context failed to initialise cipher context Impossible negative key length: %d failed to generate random cipher key The 'numbers' are in 1000s of bytes per second processed. %ld %u bits private RSA sign ops in %.2fs %ld %u bits public RSA verify ops in %.2fs %ld %u bits public RSA encrypt ops in %.2fs %ld %u bits private RSA decrypt ops in %.2fs %ld %u bits DSA sign ops in %.2fs %ld %u bits DSA verify ops in %.2fs %ld %u bits ECDSA sign ops in %.2fs %ld %u bits ECDSA verify ops in %.2fs %ld %u-bits ECDH ops in %.2fs %ld %u bits %s sign ops in %.2fs %ld %u bits %s verify ops in %.2fs %ld %u-bits FFDH ops in %.2fs %ld %s KEM keygen ops in %.2fs %ld %s KEM encaps ops in %.2fs %ld %s KEM decaps ops in %.2fs %ld %s signature keygen ops in %.2fs %ld %s signature sign ops in %.2fs %ld %s signature verify ops in %.2fs %s: -evp option cannot be used more than once %s: %s is an unknown cipher or digest %s: async_jobs specified but async not supported Too many KEMs registered. Change MAX_KEM_NUM. Too many signatures registered. Change MAX_SIG_NUM. -aead can be used only with an AEAD cipher -mb can be used only with a multi-block capable cipher %s is not a multi-block capable Async mode is not supported with -mbError creating the ASYNC job pool Error creating the ASYNC_WAIT_CTX You have chosen to measure elapsed time instead of user CPU time. Failed to to encrypt the data Failed finalize the encryption Failed initializing the context Requested CMAC cipher with unsupported key length. RSA sign setup failure. No RSA sign will be done. RSA verify setup failure. No RSA verify will be done. RSA encrypt setup failure. No RSA encrypt will be done. RSA decrypt setup failure. No RSA decrypt will be done. DSA verify setup failure. No DSA verify will be done. ECDSA verify setup failure. No ECDSA verify will be done. ECDH computations don't match. EdDSA sign failure. No EdDSA sign will be done. EdDSA verify failure. No EdDSA verify will be done. SM2 sign failure. No SM2 sign will be done. SM2 verify failure. No SM2 verify will be done. Error while initialising EVP_PKEY (out of memory?). Error while allocating EVP_PKEY_CTX. Error while initialising EVP_PKEY_CTX. Error setting DH key size for keygen. FFDH derivation context init failure. Assigning peer key for derivation failed. Checking size of shared secret failed. Assertion failure: shared secret too large. Shared secret derive failure. FFDH computations don't match. Error initializing keygen ctx for %s. Error while generating KEM EVP_PKEY. Error while initializing encaps data structs for %s. MemAlloc error in encaps for %s. Error while initializing decaps data structs for %s. MemAlloc failure in decaps for %s. Error initializing classic keygen ctx for %s. Error while generating signature EVP_PKEY for %s. Error while initializing signing data structs for %s. MemAlloc error in sign for %s. Error while initializing verify data structs for %s. The 'numbers' are in 1000s of bytes per second processed.failed to get name of cipher '%s' %19ssign verify encrypt decrypt sign/s verify/s encr./s decr./s rsa %5u bits %8.6fs %8.6fs %8.6fs %8.6fs %8.1f %8.1f %8.1f %8.1f %18ssign verify sign/s verify/s dsa %4u bits %8.6fs %8.6fs %8.1f %8.1f %30ssign verify sign/s verify/s %4u bits ecdsa (%s) %8.4fs %8.4fs %8.1f %8.1f %4u bits ecdh (%s) %8.4fs %8.1f %4u bits EdDSA (%s) %8.4fs %8.4fs %8.1f %8.1f %4u bits SM2 (%s) %8.4fs %8.4fs %8.1f %8.1f %31skeygen encaps decaps keygens/s encaps/s decaps/s %27s %8.6fs %8.6fs %8.6fs %9.1f %9.1f %9.1f %31skeygen signs verify keygens/s sign/s verify/s ECDSA sign setup failure. No ECDSA sign will be done. DSA sign setup failure. No DSA sign will be done. Usage: %s [options] [algorithm...] All +int options consider prefix '0' as base-8 input, prefix '0x'/'0X' as base-16 input. Enable (tls1>=1) multi-block mode on EVP-named cipherProduce machine readable outputEnable async mode and start specified number of jobsSpecify number of primes (for RSA only)Lock memory for better result determinismRun the speed command in test modeUse EVP-named cipher or digestTime decryption instead of encryption (only EVP)Benchmark EVP-named AEAD cipher in TLS-like sequenceBenchmark signature algorithmsUse wall-clock time instead of CPU user time as divisorRun benchmarks for specified amount of secondsRun [non-PKI] benchmarks on custom-sized bufferUse specified offset to mis-align buffersAlgorithm(s) to test (optional; otherwise tests all)Specify the name of an SPKAC-dedicated section of configurationCreate SPKAC using private keySign new SPKAC with the specified digest (default: MD5)Validating user="%s" srp_verifier="%s" srp_usersalt="%s" g="%s" N="%s" assertion failed: srp_usersalt != NULLInternal error validating SRP verifier Creating user="%s" g="%s" N="%s" Internal error creating SRP verifier gNid=%s salt ="%s" verifier ="%s" %s: Only one of -add/-delete/-modify/-list -srpvfile and -configfile cannot be specified together. Exactly one of the options -add, -delete, -modify -list must be specified. -passin, -passout arguments only valid with one user. trying to read default_srp in srp trying to read srpvfile in section "%s" Trying to read SRP verifier file "%s" No g and N value for index "%s" Database has no g N information. user "%s" does not exist, ignored. t Cannot create srp verifier for user "%s", operation abandoned . user "%s" does not exist, operation ignored. user "%s" already updated, operation ignored. Verifying password for user "%s" Invalid password for user "%s", operation abandoned. Cannot create srp verifier for user "%s", operation abandoned. user "%s" does not exist, operation ignored. t SRP terminating with code %d. Usage: %s [options] [user...] The particular srp definition to useModify the SRP verifier of an existing userDelete user from verifier fileSet g and N values to be used for new verifierAdditional info to be set for userUsername(s) to process (optional)%s: the store scheme doesn't support the given search criteria. ERROR: OSSL_STORE_load() returned NULL without eof or error indications This is an error in the loader %s: only one search type can be given. %s: serial number already given. %s: can't parse serial number argument. %s: fingerprint already given. %s: can't parse fingerprint argument. %s: can't parse alias argument. %s: both -issuer and -serial must be given. Search by issuer and serial, issuer nameSearch by issuer and serial, serial numberSearch by public key fingerprint, given in hexPrint a text form of the objectsWarning: could not open file %s for reading, using serial number: 1 unable to load number from %s bad digest, %d bytes must be specified Error during serial number generation.could not save serial number to %s %s: Must give only one of -query, -reply, or -verify %s: Must give one of -query, -reply, or -verify openssl ts -query [-rand file...] [-config file] [-data file] [-digest hexstring] [-tspolicy oid] [-no_nonce] [-cert] [-in file] [-out file] [-text] openssl ts -reply [-config file] [-section tsa_section] [-queryfile file] [-passin password] [-signer tsa_cert.pem] [-inkey private_key.pem] [-chain certs_file.pem] [-tspolicy oid] [-in file] [-token_in] [-out file] [-token_out] openssl ts -verify -CApath dir -CAfile root-cert.pem -CAstore uri -untrusted extra-certs.pem [-data file] [-digest hexstring] [-queryfile request.tsq] -in response.tsr [-token_in] ...Section to use within config fileFile with private key for reply%serror %d at %d depth lookup: %s error %s: X.509 store context allocation failed error %s: X.509 store context initialization failed error %s: verification failed Recognized certificate chain purposes: Recognized certificate policy names: %s: Cannot use -trusted with -CAfile, -CApath or -CAstore Print extra information about the operations being performed.A file of trusted certificatesA directory of files with trusted certificatesURI to a store of trusted certificatesDo not load the default trusted certificates fileDo not load trusted certificates from the default directoryDo not load trusted certificates from the default certificates storeA file of untrusted certificatesFile containing one or more CRL's (in PEM format) to loadTry downloading CRL information for certificates via their CDP entriesDisplay information about the certificate chainCertificate(s) to verify (optional; stdin used otherwise)Show some internal datatype optionsWarning: -ext should not specify copying %s extension to CSR; ignoring this Error with certificate - error %d at depth %d %s Error while verifying certificate request self-signature Certificate request self-signature did not match the contents Invalid extension copy option: %s %s: Invalid trust object value %s %s: Invalid reject object value %s Cannot use -preserve_dates with -not_before option Cannot use -preserve_dates with -not_after option Cannot use -preserve_dates with -days option The -in option cannot be used with -new The -req option cannot be used with -new The -new option requires using the -key or -force_pubkey option The -new option requires a subject to be set using -subj Cannot use both -key/-signkey and -CA option Warning: ignoring -CAkey option since -CA option is not given Warning: ignoring -CAkeyform option since -CA option is not given Warning: ignoring -CAform option since -CA option is not given Warning: ignoring -CAserial option since -CA option is not given Warning: ignoring -CAcreateserial option since -CA option is not given Warning: ignoring -extensions option without -extfile Error checking extension section %s Warning: Reading cert request from stdin since no -in option is given Error unpacking public key from CSR Certificate request self-signature ok Warning: ignoring -copy_extensions since neither -x509toreq nor -req is given Warning: ignoring -preserve_dates option with -req or -new We need a private key to sign with, use -key or -CAkey or -CA with private key Must not use -clrext together with -copy_extensions Warning: Reading certificate from stdin since no -in or -new option is given Warning: Ignoring -ext since -clrext is given Serial number increment failure Error adding extensions from section %s Must specify request signing key using -key Error copying extensions from certificate No modulus for this public key typeNo extensions matched with %s Bad output format specified for outfile Certificate input, or CSR input file with -req (default stdin)Private key and cert file pass-phrase sourceGenerate a certificate from scratchOutput a certification request (rather than a certificate)Input is a CSR file (rather than a certificate)copy extensions when converting from CSR to x509 or vice versaCSR verification parameter in n:v formKey for signing, and to include unless using -force_pubkeyOutput format (DER or PEM) - default PEMNo cert output (except for requested printing)No output (except for requested printing)Certificate printing options: Print the certificate in text formVarious certificate text printing optionsPrint the certificate fingerprintPrint both notBefore and notAfter fieldsSynonym for -subject_hash (for backward compat)Print old-style (MD5) subject hash valuePrint old-style (MD5) issuer hash valueRestrict which X.509 extensions to print and/or copyPrint OCSP hash values for the subject name and public keyPrint out certificate purposesPrint the public key in PEM formatCertificate checking options: Check whether cert expires in the next arg secondsExit 1 (failure) if so, 0 if notCheck certificate matches hostCheck certificate matches emailCheck certificate matches ipaddrSerial number to use, overrides -CAserialIncrement current certificate serial numberNumber of days until newly generated certificate expires - default 30Preserve existing validity datesSet or override certificate issuerSet or override certificate subject (and issuer)Key to be placed in new certificate or certificate requestDo not take over any extensions from the source certificate or requestConfig file with X509V3 extensions to addSection of extfile to use - default: unnamed sectionSignature parameter, in n:v formCorrupt last byte of certificate signature (for test)Any supported digest, used for signing and printingUse the given CA certificate, conflicts with -keyCA cert format (PEM/DER/P12); has no effectThe corresponding CA key; default is -CA argCA key format (ENGINE, other values ignored)File that keeps track of CA-generated serial numberCreate CA serial number file if it does not existCertificate trust output options: Mark certificate PEM output as trustedSet certificate alias (nickname)Trust certificate for a given purposeClears all the prohibited or rejected uses of the certificateReject certificate for a given purposeFailed to create null provider Failed to create library context unknown type (%u) of %zu bytes %s: unable to load provider %s Hint: use -provider-path option or OPENSSL_MODULES environment variable. %s: malformed '-provparam' option value: '%s' %s: Error setting provider '%s' parameter '%s' %s: No provider named '%s' is loaded error: setting distinguishing ID in certificate failed error: setting distinguishing ID in certificate signing request failed Warning: certificate from '%s' with subject '%s' %s The server does not support (a suitable version of) TLSTLS handshake failure. Possibly the server requires our TLS certificate but did not receive itServer did not accept our TLS certificate, likely due to mismatch with server's trust anchor or missing revocation statusCannot authenticate server via its TLS certificate, likely due to mismatch with our trusted TLS certs or missing revocation statusThe server does not support HTTPSassertion failed: mode == 'a' || mode == 'r' || mode == 'w'problem loading oid section %s problem creating object %s=%s %s: Could not allocate %zu bytes for %s static unsigned char %s_%d[] = {error converting serial to ASN.1 format Error creating random number to store in %s Unable to load number from %s Error converting number from bin to BIGNUM Error creating serial number index:(%ld,%ld,%ld) Error creating name index:(%ld,%ld,%ld) %s: %s name is expected to be in the format /type0=value0/type1=value1/type2=... where characters may be escaped by \. This name is not in that format: '%s' %s: Error copying %s name input %s: Missing '=' after RDN type string '%s' in %s name string %s: Escape character at end of %s name string %s warning: Skipping unknown %s name attribute "%s" %s hint: a '+' in a value string needs be escaped using '\' else a new member of a multi-valued RDN is expected %s warning: No value provided for %s name attribute "%s", skipped %s: Error adding %s name attribute "/%s=%s" Hostname %s does%s match certificate Email %s does%s match certificate IP %s does%s match certificate SSL_CTX given but use_ssl == 0Error configuring OpenSSL modules Can't access file descriptor %s Invalid password argument, missing ':' within the first %d chars Invalid password argument, starting with "%.*s" Error reading password from BIO Error getting password for %s Trying plain input string (better precede with 'pass:') Out of memory getting password for %s Internal error: nothing was requested to load from %s No filename or uri specified for loading Could not open file or uri for loadingLoading %s over HTTPS is unsupported Unable to load %s from %s (unexpected parameters type) error: HTTP retrieval not allowed for %s error: unable to load %s from file '%s' Warning: error while verifying CSR self-signature Warning: CSR self-signature does not match the contents %s: Can't open "%s" for writing, %s Error writing to output file: '%s' %s is invalid, it should be "today" or have format [CC]YYMMDDHHMMSSZ Error setting notBefore certificate field Error setting notAfter certificate field %s: end date before start date Warning: generating random key material may take a long time if the system has a poor entropy source Warning: generating random key parameters may take a long time if the system has a poor entropy source %s: Generating %s key parameters failed OpenSSL application user interfaceCould not allocate %d bytes for %s No engine specified for loading %s No engine key id specified for loading %s error detaching from parent process group: %sinternal error: no matching child slot for pid: %ldchild process: %ld, exit status: %dchild process: %ld, term signal %d%sinternal error: no free child slotserror setting accept on port %sHTTP/1.0 200 OK %sContent-type: %s Content-Length: %d sending response, 1st line: %.*sawaiting new connection on port %s ...cannot parse HTTP header: missing end of lineinvalid %s -- URL does not begin with '/': %sinvalid %s -- bad HTTP/version string: %sinvalid %s request -- bad URL encoding: %scould not allocate base64 bio with size = %dHTTP request does not begin with %sPOST: %serror parsing HTTP header: missing end of lineerror parsing HTTP header: missing ':'error parsing DER-encoded request contentout of memory allocating %zu bytesreceived request, 1st line: %s%s: Can't parse "%s" as %s number %s: Can't parse "%s" as a number %s: Bad format "%s"; must be one of: %s: Unknown option or cipher: %s %s: AEAD ciphers not supported %s: Unknown option or message digest: %s %s: Value "%s" outside integer range assertion failed: unknown_name != NULLassertion failed: unknown == NULLassertion failed: unknown->valtype == 0 || unknown->valtype == '-'assertion failed: opt > OPT_V__FIRSTassertion failed: opt < OPT_V__LAST%s: Internal error adding Policy %s %s: Internal error setting purpose %s %s: Extra argument after %s: "%s" %s: Extra (unknown) options: "%s" "%s" %s: Option -%s does not take a value %s: Non-positive number "%s" for option -%s %s: Negative number "%s" for option -%s %s: Invalid format "%s" for option -%s %s: Multiple %s or unknown options: -%s and -%s Checking cert chain %d: Subject: s_cb.c:security_callback_debug op=0x%xKeylog callback is invoked without valid file! unable to get certificate from '%s' unable to get private key from '%s' Private key does not match the certificate public key error setting certificate chain error building certificate chain Supported Elliptic Curve Point Formats: read from %p [%p] (%zu bytes => %zu (0x%zX)) read from %p [%p] (%zu bytes => %d) write to %p [%p] (%zu bytes => %zu (0x%zX)) write to %p [%p] (%zu bytes => %d) Not TLS data or unknown version (version=%d, content_type=%d)TLS %s extension "%s" (id=%d), len=%d error setting random cookie secret Error calculating HMAC-SHA1 of buffer with secret %s: %zu-byte buffer too large to hexencode matched the peer raw public key No peer certificate or raw public key Call to SSL_CONF_cmd(%s, %s) failed # SSL/TLS secrets log file, generated by OpenSSL --- No %s certificate CA names sent --- Acceptable %s certificate CA names Secure Renegotiation IS%s supported This TLS version forbids renegotiation. application layer protocol negotiation bad_certificate_status_responseassertion failed: (family == AF_UNSPEC || family == BIO_ADDRINFO_family(ai)) && (type == 0 || type == BIO_ADDRINFO_socktype(ai)) && (protocol == 0 || protocol == BIO_ADDRINFO_protocol(ai))Can't bind %saddress for %s%s%s assertion failed: (family == AF_UNSPEC || family == BIO_ADDRINFO_family(res)) && (type == 0 || type == BIO_ADDRINFO_socktype(res)) && (protocol == 0 || protocol == BIO_ADDRINFO_protocol(res))SRP param N and g are not known params, going to check deeper. SRP parameters set: username = "%s" info="%s" Failed to initialize SRP verifier file Cannot initialize SRP verifier file "%s":ret=%d \yyL{ZVVVVVVWW0WAWRW7V7V4Q\|\\]]]]^^ ^1^@^Q^b^[[[[[\\\\\]]$]5]F]W]h]y]]]][ \\,\<\L\\\m\~[[[`[o[4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4Q4QDUDUDUDUbbbqb,`bsave_free_certsprint_statusprint_itavssave_keyspecdelete_fileprint_keyspecsave_templatesave_crldo_genmhandle_opt_geninfoset_nameset_gennamesset_fallback_pubkeysetup_request_ctxsetup_protection_ctxsetup_ssl_ctxsetup_verification_ctxtransform_optswrite_PKIMESSAGEread_PKIMESSAGEread_write_req_respsetup_client_ctxcmp_serversetup_srv_ctxopt_strget_optsset_verbosityread_configprev_itemcmp_mainmock server  Ҋ zjZJ0 я{of]TH?3' `P@ӑp ܌+΍^@Q qP Ԥ^X<xxH8طȷpX@и0ж}xlL\| <dT<,txh8(x`dtdTD4@0xdihN`rŽ8x"""ȭƾ־ȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭȭRRRRRRLets print some clear text pP@0 x@0 GET %s HTTP/1.0 4 \%@P ,,|\<|l\L<,,t\D,l<$ 8BA/DFDGGGG}GpG8GFAAAA|A{HmH[H3H$HGGGHH @0123456789ab4Vx4VxVx4x4V4Vx4VxVx4This is a key... @@ @@@@?@p`P0 ppP@ p ""h4DDTd4||||,dL,$ ,<$|dL$< ( P( h X x h T<,\D,4$T$$ T ,t$T$d$t$dTt !4!T!t!!!!!"$"D"d"""""$#<#T#l#q#####$$$<$D4 IDGH IHHHlHKTJJKJIJILdNNNMLОh0app_http_get_asn1load_index4||||||||||||||||||||||||||||||||||||||||||||4|||||||||||@|||||||||||||||||||||||||||||||||||||||||| |||$||tt4T|tt4ThxH(hP8 x`H0    (p     p p p P-P-S-M-H@(PPPPPPPPPPPPPPPP8PPPPPP PP PPPPPPPPPPPPPPPPPPPPPPPPPPPP66b666666B66B6666666666666666666666666666. 54(5555X55.+* ;\80`` tr 8 9 X] 8 ȋ !TQ$p%x&')LP./P0L055`7 7X@8t8`99:$;P;|0<<P=>Lp>l??`@@`KP RR0g(ij mX p ( dp0@  !!("@""##0$`%T-0(.`K3K3L3MD4pN4N4O5p5Б5H66`7x7P78 9p909 @:`::;l;;P<<h<<  =`p== > D>>-> 2@?@3?p>@E@`G@@H A@NpANAPAPAQB@S|BSBUCU0CWC0XCpZ DZHD\D\D^8E _`E@aEaEaEc`FcxFdFdFfWA(X`B~ >~0>~@>~>~A0CpCD@DD0Hl@HI`JJKHLMN<NPOh O|`OOpPP0PDQST,UxPV`VĄWW(W<WP0XXԅYZ@Z\[x[ \]^<^P_t@__0`aLbbԈc dlPgpgg iXjkpmXPnxpr8@sdsxwԌx `y\z0{؍p|(}t~$`P` (8@lP`І 0$X`P<phГ,|(pУ0D @l0@̗Ъ4`0|̙аh 0Ě0Pě08d ` `@@`@ܝ4PL h`p(px$Dh@|`pР0 \@x`@L ܢ`pp̣x Фp 00D@Xpĥ0\`Ȧ0`h0Ч (dp  04@HP\ppp, x PLd,px` !h"p$&,@)`*.|0/12Dp2h2|23@46$09<б= >lp@@ԲAB`@CCpI0@JdKQ R8 RLTUȵVW@WTXzRx p"zRx $0gFJ w?;*3$"D L\mFBE D(D0g (F BBBP q (C BBBN 0EAG p CAO dHALZFBD D(D0u (F ABBL t (C ABBL H0=FBB B(D0D8D 8C0A(B BBBM `|KBD D(G0@ (A DBBK D (F ABBQ D(C ABBLL 2FBE D(D0T (A BBBH q (C BBBN d0FBB E(D0D8D 8A0A(B BBBR  8J0A(B BBBH tzEk P s4BDD Q4  AABM HL!FED D(G0S (J ABBL a(H FDB<!NA|(X!EAG y AAH (("EAG y AAH ("EDD t AAM ("EDD t AAM (T#EAG x AAI (4#EAG x AAI (`$EAG y AAH ($EAG y AAH ($EAG y AAH HH%FED C(D0s (F ABBL t(C ABB0%bEU N s P%EY J s M tx&bEU N s0&EAD Y(O0T(A DAt'(E^L' FBB B(H0D8G 8D0A(B BBBL L42BIE B(A0A8GV 8D0A(B BBBR 4x8[BDD Q ABR _ABL8BFB B(A0A8G 8D0A(B BBB_ MJBEE J(K0A8D@HMPNXH`HhGpGxGGAHHGGGHGGGG\@Z 8C0A(B BBBS HN8FBB B(D0A8G@ 8D0A(B BBBG HO.FIB H(A0A8D` 8C0A(B BBBQ L<R"BBB B(A0A8GL 8D0A(B BBBV pT3FBB B(A0A8G L&/ 8C0A(B BBB\ &J&U&A&&G&B&H&H&G&G&D&G&B&H&B&G&G&G&H'G'G'G'B'~&b&B&B&H&H&G&G&D&G&B&P&H&G&G&G&H'G'G'G'B'C&`&L&H&B&H&A&G&H&D&G&H&G&G&G&H&G'G'G'B'G'G'G'k&S&B&H&A&H&A&G&H&D&G&H&G&G&G&H&G'G'G'B'G'G'G'k& X &| `P \FIB E(D0A8I 8D0A(B BBBT  ؋ 8 AW X R_ O(C0Pfa O(C0P(H ADD ^ AAG 4t (BKK x ABM @ABd wBAA ~ ABS L ABY M(V0U8H@K I(V0U8H@K _(V0U8K@I  BAA \ ABU K ABR D(Q0U8Q@I Q(Q0U8O@K O(V0P8P@I D ABV Q(Q0U8O@K $FBB B(A0A8G@ 8D0A(B BBBS HVPUXO`I@tHVPUXH`K@RHVPUXH`K@_HVPUXH`K@x$ BBE H(A0 (A BBBR ^ (A BBBS D8Q@UHRPI0O8Q@UHRPI0^8Q@UHRPI0P LGAI j FBU QABTX D(V0U8H@K ؕBBB B(A0A8D`z 8A0A(B BBBV hVpUxOK`ShVpXxHK`jhVpUxOK`KhVpUxOK`BBB E(A0C8GP 8C0A(B BBBP \XR`XhHpIP]XU`PhKpWPIXV`UhHpKPIXK`OhIp\ BEE A(D0 (D BBBT D (A EBBR D8Q@VHIPI0HlFDG M FAS YAAUX D(V0P8O@I 84BBA A(Do (C ABBO t؝BBB I(A0H8N 8A0A(B BBBY |VVHK<VUQIlPLBEE B(A0A8DFTA 8D0A(B BBBP IROBIWRVPZCVUHK]VUOIbVUHKMVUHKjVUHKRVUOIIVUTI)BBB B(A0A8G`Y 8A0A(B BBBT KhVpUxHK`NhFpThA`hVpUxHK`hVpUxOI`xhVpUxHK`chVpUxOI`ShVpUxHK`hVpUxOI`PhVpUxHK`bhVpUxHK`_hVpUxHK`6BBB B(A0A8JHDBFS 8D0A(B BBBZ ` URAH _OAK= DUAO HnAzURMWMNVPI_NVPI_UKAa^WROK_WROKKWROK[WROK_WROKMNVPIP URAG \NVPP URAO oNVPIPWROKMNVPIh URAG [NVPPj URAO  URAF DNVPISNVPI UKAL _ URAE RJSPI{ RUBE KUOKiRUOKj_OAKINVPIhKUOK DUAL \ RUAL vOPHRN DNHE { RPKKcLRBE sKUOKcJVOKw DUAE iJVHQFRUOK\RUOKFRUOKXRUOK[RUOKRUOKFRUOKNKUOKNKUOKNKUOKS DUAE yKUHKR DUAE KVOKkRUOKNKUOKFRUOKcKUHKVSFIKUHKa DUAE ARUOKa GRAE IKUHKaKUHK[KUOIZJVOIa RUAE \ DUFE [KUHKNKUHKf DNAE e DUAE p GRFE R]IPI_ODI DUBE ] DUBE oHAAKvKUHKZJVHKYKUMI^KUKIlRHAKeOUCLYKUHKFRUOI[KUHKADOH8 BBB B(D0A8D@  8D0A(B BBBU WHVPUXH`K@lHVPUXH`K@rHVPUXH`K@MHVPUXH`K@ZHVPUXH`K@VHVPUXK`I@VHVPUXH`Q@lHVPUXH`K@VHVPUXH`K@T !2FBB B(D0A8GLVUHKb 8D0A(B BBB_ bVUHKeOHKVUHK}VUHK2VUHKnVQTIjVQTIRVUHKVVQPIhUAFg6NCHPOUJIqOUHKoVUHKVVUOIxOUHKXVUHKIVUHK[OUHKMOUOK`OUOKdOUORwOUHKeOUHKEEB]JOAJVOImOUHK GAFE OUHKpOUOKHVUHKOSUKSORQPNOSUKNOUOKFRUMIOQOKWVQOKcOQOK|OQORqOQOKXOQOKgOQOK[OQOKOQOKVQRIhOQRICVQRIkRUHINOQRIOVQRISVQRIOQVINOQVOFVQOR[OUJIlOQOKMOQOKSVQOKSVQOKSVQVI$d @EFG eCAH @BBE E(A0D8FP 8D0A(B BBBQ L BBB D(A0x (D BBBS h (D BBBV H(!BHD A(F0z (F ABBN h(C ABB4t!kBAK  FBK ACBD!BEI I(A0A8DP8A0A(B BBB!5FBB B(A0A8I 8D0A(B BBB[ D)DnBBGBBfAKSAD`AL"O^ FEE I(D0A8I 8D0A(B BBBV L"[FBE E(H0F8Kp 8D0A(B BBBQ L,#PaFBA K(G0U (A ABBJ  (D ABBN ||# bBBB B(A0D8GP 8M0A(B BBBM l 8A0A(B BBBJ  8I0H(B BBBE \#@dBBE E(I0A8D 8D0A(B BBBP KYA\\$`feFBB B(D0D8G 8A0A(B BBBU rGYC$piFBB B(I0A8G  8D0A(B BBBY HEB_MDBEBBo BOBvENAtBEB_ABEBBo %8%8yBBA H(G` (A ABBI `%zFBE I(G0C8K 8D0A(B BBB] NHBLT&!FEB E(H0A8P 8D0A(B BBBR &\&HFEE I(G0C8K 8C0A(B BBBT JUAL$'ؑ7FBI E(D0A8P 8D0A(B BBBW Lt'șn FEI H(D0H8I 8C0A(B BBBY 8'FAD Z ABP T HDH L(| BFE D(A0 (C BBBL A (F BBBK P(< FBB E(A0A8GE[B 8A0A(B BBBV  O^BB`AH(BBE H(D0A8DPe 8A0A(B BBBO ( ) EDGx AAN dL)BBB B(A0A8G 8A0A(B BBBO A 8F0A(B BBBH L)V FBB B(A0A8I 8A0A(B BBB_ L*;FBB B(A0A8G 8C0A(B BBBI 8T*FIA A(G0V (C ABBJ \*<BBG E(F0D8I@P 8C0A(B BBBQ R8A0D(B BBB4*gBHG C(D0~(C ABBH(+oBDB E(D0D8GP:8A0A(B BBBLt+DFBB B(D0A8G 8C0A(B BBBV \+2FEB E(H0A8MLQA 8D0A(B BBBX `$,FBB B(A0A8D@] 8C0A(B BBBU H 8F0A(B BBBY `,! FBB I(A0A8I 8D0A(B BBBX MUAt,`+FBB B(A0C8Do 8A0A(B BBB[ 3IPBIOALd-FIE H(D0X (F BBBL h (A BBBQ L-BBE D(G0` (A BBBU Z (A BBBO L.FEI E(A0H8K 8D0A(B BBBX $T. 2EDD XGA<|. BIA K(G  (A ABBK .'KT$.BEDD hGA`.>BBB B(A0A8N@ 8D0A(B BBBH K 8J0A(B BBBJ $`/BEDD hGA`/BIB B(A0A8D@ 8D0A(B BBBH K8J0A(B BBB$/BEDD hGA`0BIB B(A0A8D@ 8D0A(B BBBH K8J0A(B BBB$x0DBEDD hGA`0l>BBB B(A0A8N@ 8D0A(B BBBH K 8J0A(B BBBJ $1HBEDD hGA`,1pBIB B(A0A8DP 8D0A(B BBBH K8J0A(B BBB$1BEDD hGA`1BIB B(A0A8DP 8D0A(B BBBH K8J0A(B BBB$2BEDD hGAHD2BPB B(A0C8D@ 8D0A(B BBBH $2BEDD hGA$2BEDD hGA`2BPB E(A0C8D@ 8A0A(B BBBR s8J0A(B BBBD3X0H_4\3pEKD W FAN k FAN $3BEDD hGA`3BPB E(A0C8D@ 8A0A(B BBBR s8J0A(B BBB$ 4|BEDD hGA`H4BPB E(A0C8D@ 8A0A(B BBBR s8J0A(B BBB$4 !BEDD hGA`4H!BPB E(A0C8D@ 8A0A(B BBBR s8J0A(B BBB`85"kBIB B(A0A8D@ 8D0A(B BBBH K8J0A(B BBB$5#BEDD hGAH5#FBB D(A0S (A BBBO S(A BBB6L$]EX S NH06$FBB D(A0S (A BBBO S(A BBBH|6$FBB D(A0S (A BBBO S(A BBBH64%FBB D(A0V (A BBBL D(A BBBH7x%BBB B(A0A8F` 8A0A(B BBBP H`7'FBB D(A0S (A BBBO S(A BBB<70(EDG s NCL D AAR aCAH7(FBB D(A0S (A BBBO S(A BBBH88(FBB D(A0S (A BBBO S(A BBBH8H)FBB D(A0S (A BBBO S(A BBBH8)FBB D(A0V (A BBBL D(A BBBH9)FBB D(A0S (A BBBO S(A BBBHh94*FBB D(A0S (A BBBO S(A BBBH9*FBB D(A0S (A BBBO S(A BBBH:*FBB D(A0S (A BBBO S(A BBB0L:0+MEDG M AAQ SDA4:L+sFAD f ABL eDEP:+z FBB I(K0C8Gu 8A0A(B BBBY L ;KBBE D(G0` (A BBBU Z (A BBBO L\;PLFIE B(D0H8K 8D0A(B BBBN L;S!FEE I(G0A8KP 8D0A(B BBBQ d;UFEE E(D0A8FPeXG`MhDpDxIAGSPT 8D0A(B BBBR d<V)FIB B(A0A8I 8D0A(B BBBV ,EBIQxO[AIQYA@NZAVBBNHGHqOfB I^BL=P`=Lt=H=D=@=L =H)@=dBBB A(A0Dp 0A(A BBBN >@YR08>TFBB B(I0A8DLl>oFBB B(A0A8DpW 8A0A(B BBBM L> BBB E(H0D8D 8A0A(B BBB_ L ?BBE B(D0D8J 8A0A(B BBB\ \?FBB B(A0A8G L@IAAUAEAEARA 8D0A(B BBBO oAOAEAEARAvAKALABARA(?8EAD0t FAG @ @BBB A(A0DP 0A(A BBBX 4d@XlFDC y CBM HAB@AFBA A(DJ (M ABBF R (M ABBL  (A ABBS ^ (K CBBH z (I HBBE H$AXFBB B(D0A8G@; 8F0A(B BBBN `pAFBE E(G0D8G`hHpThA`hMpZhA`] 8A0A(B BBBV PAFBE E(D0D8FPfXH`VXAP\8A0A(B BBBT(BFBH E(D0A8D`hGpVhA` 8C0A(B BBBR B#FBB B(A0A8G L#m 8D0A(B BBBU 3 #R#[#A##D#D#A#E#B#E#B$n#Q#H#Y#B##F#Y#A#<,C@iJLD E(G0g(A ABBMLlCpUFEB E(H0A8F> 8D0A(B BBBT C+ FEE I(K0C8L  8C0A(B BBBZ  I N A c I P A  E G A tDD( FEI B(D0A8P 8D0A(B BBB[ IMB\JKALDpuFEE I(G0C8K` 8C0A(B BBBN  E EiFBB B(A0A8G L# 8D0A(B BBBX  #G#]#B#~#G#]#A##K#R#A#h#B#W#B#LEFEE E(D0H8N` 8C0A(B BBBS L F FBI H(G0H8Fpv 8D0A(B BBBO \FpFHF?BLB E(G0M8JP 8A0A(B BBBW PF\BBB B(A0A8G I  8A0A(B BBBU l$G BBB B(A0A8G!CcBVbA 8A0A(B BBBX \GoFHB A(H0D@ 0C(A BBBL } 0D(A BBBE GHH0HDH XHlH \HBEE E(A0G8DPE 8F0A(B BBBO a8C0A(B BBB`H< \BEG H(D0D8GP 8A0A(B BBBT  8A0A(B BBBP DI8"8FBB I(A0C8IJ 8A0A(B BBB\ XOUBIQAK^B_MWBK]ALIY FBE E(H0A8P 8D0A(B BBBP FBE D(D0F@ 0A(A BBBV HKxqFBE B(D0D8G` 8A0A(B BBBQ HL(toZBDG yAN\oBBB H(D0C8G@X 8A0A(B BBBR D8G0H(B BBBpL pHH(pTBEE E(A0D8G@Y 8D0A(B BBBM ptpAFBB B(A0D8D@VHOPJHA@m 8G0A(B BBBN  8D0A(B BBBR $pFo K a O ] G HqlBBH E(A0C8DP 8A0A(B BBBJ 4\q@BMK Q ABR AHBq Lq FGD D0b  ADBR s  AABY f  AABV qd rp r| 44rxSFDD g ABH IABHlrjFED D(G0e (C ABBI I(C ABB8rFBA D(D@U (D ABBQ ,rFJD b ABO $sH'JL@s\;JL\sEG(xs$UFPD Q ABI LsXFBB D(A0e (A BBBM (C BBB(sEDD P AAQ  t Dh>FBE D(C0IW 0A(A BBBT @Tdd̐@@d@FBB B(D0G8D@u 8A0A(B BBBN D 8M0A(B BBBN @\ABMM K`  HABE T  MHBE \B8CYE} N DԑxCCHr$CQEHD rDAC (C8<C&FAD ~ CBJ p ABM ,xKgFAD  HDG 4MFDD @ FBJ oCB0|M_EFD W CAN \CA(MEAD0 AAM 4@\NFDD @ FBJ oCB0xN_EFD W CAN \CAN$EZHȓOFBD D(D0x (F ABBI K(C ABB4xOFDD l FBN HCB8LOFBA D(D@ (A ABBG (PEAG0E CAJ PUH A G 8Д,QFBA D(D@ (A ABBG 8 QFBA D(D@n (A ABBK 8HDRFBA D(D@n (A ABBK R%(ReEAG  HAU ĕ(T (ؕ$TEAD0 AAQ X X ,X@XTX+H`4lY EAG B AAO h AAN LYPFBB B(A0A8G* 8A0A(B BBBO \iKR G H<]sFBB B(A0A8Db 8A0A(B BBBR \adp|b8FBB B(A0A8GPZ 8F0A(B BBBR T 8A0A(B BBBR TؗTdDFEB E(D0A8DhYpEhA` 8C0A(B BBBO 0LiXWbHiAa N NhjPBBB B(D0G8DeJNBGZA 8K0A(B BBBH KOBc 8A0A(B BBB[ DGZAHlFBB B(A0D8IPF 8C0A(B BBBT @\oKDI xFBHP h ABM \pOED D(G0W (F ABBS f (A ABBL X0Hq`FBB B(G0A8Dp 8F0A(B BBBL HLt7FDB B(A0D8DP 8F0A(B BBBR HuFDB B(A0I8JPY 8F0A(B BBBI (hv EFD FAV tLxFEB E(D0A8G@bHUP^HB@D 8D0A(B BBBZ xHdP]HA@o HUPJ pHdP]HB@DzFAH W QIP L ABQ ] CBN Лl{FII E(A0D8GCJRBx 8A0A(B BBBT A[A ROAA L O E ,`~FMK r CGF `|LFBB B(A0D8GPXN`MhPpAxBIP} 8C0A(B BBBS 0hFAA Dp  AABP (āUED  AG L `(toJHG AAN0L&EAD  FAU cCA0ԝHFAA F0  AABI \Ԅ)FBB B(A0A8G 8A0A(B BBBU D^AHhfFBB B(A0A8Dp] 8A0A(B BBBO LȊFEH A(A0[ (A BBBI w (A BBBR Hx~FEA D(F0w (F ABBH L(F ABBHPOFEE E(A0A8GPs 8A0A(B BBBU JLy(EDG f AAP \FBB G(A0L (A BBBK b (A BBBO A(D LDB0DHEGG L CAM DMA(xEAD0u FAI lFBE E(A0D8G^ 8D0A(B BBBW DTWAKaB08FDD D0m  AABM HHԕFBL E(D0C8G`r 8C0A(B BBBK X(FEB B(D0D8Jv 8D0A(B BBBT DWOB(PEP K U K IМ L0̜FBE A(D0H (F BBBR  (C BBBQ (EFD@d DAP (EDG w CAU HآFBD D(G@j (G DBBP t(D ABB$8@84FDD J0m  FABR c  AABI 0|gEDG f FHL DMAGNUm@m ͺ  _ W U (P@<@h`ؿпȿ(@xtph`XPH$@8@4@0@xpXPH@80( H@@@@0( @ؾоȾxph`XPH@80( @@ܽؽH- M Q [             & + 0 6 /@ f8@ g A@ hJ@ iS@ j >`` `- @ @f!<? \@ f@ o@ x@ @ @  @ @ @ @ @ ;@ @ @ @ @ ;@ @  A A -A =A  > '> MA ?@UA @r[A dA mA vA A A A A A A A A A A A A A A B B B ,B 9B DB MB WB aB kB uB B B B B B B B B B B B B B  C C %C 3C /@ 8@ A@ J@ S@ AC HC PC XC `C hC pC I8 M8    i  i R8 yC v \8 f     :  q C C C C q S C u  x C C  C C X X X X X ж X X @X X  Y ) Y "Y 7Y KY YY `Y ``hY `nY `D * @`tY }Y Y Y OY Y Y Y Y Y Y Y Y Y @Y Y Z Z Z %Z 3Z ?Z IZ SZ  q] d =d j j 6j Fj Uj dj qj ~j k j j j  j j #j j j  k k (k t36k  Gk ^k sk 3}k + )k -k /k 1Lm *E- - * <. E-L Z Au K < ) >0u a g p j p p`u su Eu ò su ˲ v ղ sڲ E E- +Q " w 5 N p0v E- E- - - {& 5-  /% K <> Z F X *-@ ) >h ` s h -؅ o -u ɷ "- +<8 ,<h y[ s E- Q s iE sȆ T s ' sл E-  s ж -  -H Ҹ 4-  - < s # (s. ^ s F )sP  ph  /s f 0<؈ n -y - E- f s  s Q f8  sp g s VT <ʼ . F ּ -(  sX ߼ sx E- !- DT .s z 1s  2- : 3s B FsM M GsH V Hs e Is؋ w #s $sh %p &pЌ 'p 8 -< E-˽ s >P E- Bsx As  Ds Cs E-?_ * P E- E- - E- -Ȏ ` - -ž s E- l\ - 5$ - P$ -8 o$ -X $ -x  - E - s E- Bsx As  Ds Cs E-?_ LD - Q s T s , NP E- s  s E  s8 ! s E ) s( 2 sp E- : s A s@ L -h Z s I s E@ E  N d s Eh l s q -  sH s - n EX s s -( -h E s s E-X s E E 1V sh E R s !n@ E E- "s E  #sp  $s E 6 %sP  &s  'N ) (N@ 5 )N E- *s EC ] +s@ \ ,s d -s r .-( /-x E E 0-` 1s 2s 3s@ 4s 5s 6s 7sh 8s 9s :s( E-`  ;s a <s VT =s E` E >s g ?s @sX h As Bs Cs8 E D- E- . Es , FsP Q Gs 4 Hs y[ Is Eh E- Bsx As  Ds Cs E-˽ s >P E-> W - ` s i s@ q sp } s s EH sp E- o - p( sp - s s0 sp s - E- #' s8 Np  s s  s 9 s` A s M s Y s g sH p s y s E sP s s s s0 sx s N NP -  N m N  Nh  s ) - 4 - E -P E E U -( h -` z - E- ' s s s n n M ) s9 P s] q s{ - - -@ - -  -h . - : - F - R -_ | - - - -H -  -p  - 6 - D - R - ` - E- - E- K < ) > Q F< E- @ - @ - p - @ -% ; -B Z - g <( h sh v - - - -  -P - - - - E- Z c + c 3 /F; m (-O v (-d t )-| #-H *- - E- <s :s ;sP Fs  >s Hs Q Gf y[ Ps  E- Bsx As  Ds Cs E-˽ s >P E-P  s 7 C<= Q .x - Os Y K-e | L- M- N- -( E- f Es  Bs ) 0<p E 2 - 8 -A T -@ \ -p c !- n "- ~ -- .-  Is` Js E-  s 7< &-8 '-`  %-  -  - 2 - ! -0 M 1<0 W 2/X a 3:x J 5- T 4- ^ 6- E- $-i =s > -P D> ?s @s I As E- a +-x 8- 9s ,- E- ' s s s n n M ) s9 P s] q s{ - - -@ - -  -h . - : - F - R -_ | - - - -H -  -p  - 6 - D - R - ` - E- - @ - E-- K <= Z F g < Q F E- ) >X + Fu ` s > -H L - Q -h s - E- 1V - { - - a -  - -' 8 - ? < E- W /0 M <X a : J - T - ^ - E- Bsx As  Ds Cs E- - E-- K < Z F - ) < E- ) > + F E- Bsx As  Ds Cs E- E- - -Q y[ s  ^ -  s E-  -0  -X ) > Q f -j -| p [ - ! - E- p s @ sp s  sX h < s s  s -  - E-˽ s >P E- Bsx As  Ds Cs E-?_ X E-  E- - -0 H -@ y[ s  E-- K < Z FQ E- ) > + Fj > -p a - f - o - ; -( - {& - E-˽ s >P E- Bsx As  Ds Cs E-?_ ` E- - - - -( - y[ s  E-- K s Z fP -  s E- ) > + f a - > -- G -C ^ - e s E- Bsx As  Ds Cs E-  E- - y[ s  E-- K < Z F E- ) > + F > - a - - {& - - E-˽ s >P E- Bsx As  Ds Cs E-?_ P  E- - y[ s E-- K s Z f -  s - -  s  s E- ) > + F a - > - - ^ - -0 e s E- Bsx As  Ds Cs E- - -h y[ s - K < Z F ) > + Fu E- > - a -  s E-3 -G b - n -( iE s`  s E-˽ s >P E- Bsx As  Ds Cs E- - - - Y - [ - 5 - W - y[ s E-- K < s % <+ E- ) >  sE - < -( -W [M -` E-4 i - -o - ! - s s s 9 s f s  p! E b -8! Ep! - p! E j -!  Fs"  GsP" - E-˽ s >P E- Bsx As  Ds Cs E-" E- - -# . sH# 2 s# E- d-# 9 e-# 8 f-$ 7 g-@$  -`$ < -$ E$ E-?_ y[ ? E-$ E- - E-?_ [ b E- - -& @ -& <' s s8' b -h' x -' --( .-8( -p( -  -( ! -( 8 -G a -p - -) -@) -h) -  -) . !-@ U "-) k -) -* -@* @ #- $- %-h* &- > '-O k (-{ )- *- +-* ,-* E-- K <* E- ) >*  sG=  s(+ EP+ a -+  s+  s+ Q <G {& -c E-8, E- - y[ s E- ) >`, e s E-˽ s >P E- Bsx As  Ds Cs -, - {& - E-?_ , E- - y[ s p <z s -. {& -(. sX. Q < E- ) > > + F  s  - > -' -. E- Bsx As  Ds Cs E-˽ s >P E. E- E- - y[ s E-- o -/ - 0 - 0 E- ) >X0 e s p - {& - F-0 -, E-˽ s >P E- Bsx As  Ds Cs E-?_ E- - E- 1 -0 ; -0 F -0 Q -(1 X -c - - -yN - E-m E- - sP1 LD s h s s E-1 s1 E- ) > -1 E- Bsx As  Ds Cs E-?_ E- - E- o -b -u s - - - -4  -H4  -p4 ) -4 : -4 L - 5 [ -P5 3 -x5 k -t - - -5 -5 -5  -  -6 / -86 E -[ y - - -`6 -6 o$ !-6 $ "-7 -  #- Q - WN sP7 2 -x7 E- Bsx As  Ds Cs E- E- -  s7 LD s h s E-P+ E-- K <7 E- ) > -1 E- Bsx As  Ds Cs E-?_  E- - E-- K < E- - ) > E- Bsx As  Ds Cs E- - -p: M !<0 W "<X a #:x J $- T %- ^ &- E- - p: -: 7 p; -@; 8 -x; N 1< 2p; 3p; s<  <@< <h< 0< 4p<  5<<  6<<  ;s = 7<H=  8sx=  9s= ] :s 8 <s= -> E-= / sN sH> #' N\  ,su  sp>  s E ) >  - L - -> -> -?  -0? > -P?  - 4 -> Z -c  -x? -? -? -@ sP@ < <x@ VT .<@ R /s@ 'uA )s@A *shA +sA 1V -<  (p% E- ' s s s n n M ) s9 P s] q s{ - - -@ - -  -h . - : - F - R -_ | - - - -H -  -p  - 6 - D - R - ` - E- Bsx As  Ds Cs E-B E- - E-?_ B E-C E- - E-- K <2  -C _ -K E- {& -e -q - E- s  -C ; -C  -D o - -HD E-˽ s >P E- Bsx As  Ds Cs E-?_ pD E- - K #< ) $>  %s e &s 'sxI ( -I 0 -7 T -Q a -I ( I-J y[ .s E- Bsx As  Ds Cs E-˽ s >P E-HJ -xJ -k -J - -J - -J E-K ! - s@K ) <pK sK CK -K EK ] <8L M )< W (/ a *: J ,- T +- ^ -- iE s& "shL !s@ -L -L -L sM S sHM -M sM [ G-N i Hs0N  p`N  -N -z  -N  p  -  FsN E- - y[ s E-- K < Z F E- + F ) > a - > -XO -O  -O {& -O E- Bsx As  Ds Cs E- - y[ s s  s 1 s(P E-- K < Z F7  s Q -XP E- ) > + FY t -z e s -P  p  - pP EP E-  -  s  s . s7 E-˽ s >P E- Bsx As  Ds Cs E- - y[ s E- Bsx As  Ds Cs -  - E-- K s Z f8R  s -hR E- ) >R + FR -R e s S -HS ^ -S a -S > -S  -T  s0T  shT E- - y[ s -J E-- K < E- ) > > -f a -T E- Bsx As  Ds Cs E- - y[ s ^ -`Y p -Y @ -* @ -Y @ -Y A -Z H F-N h G-n Q J< E-- K <= sHZ -  s  spZ  EZ  -Z \Y -Z  <[ Q E8[ E- ) > a H>p[  -[  -  -[ E-(\  K-X\ h Ls\ s\  s]  s   p$ @ Is`] E-˽ s >P E- Bsx As  Ds Cs E-] E- -  p * p E- -1 @ -< M -] E- Bsx As  Ds Cs E-?_ 1 ] E-p^ E- - y[ s E- ) > - - E-˽ s >P E- Bsx As  Ds Cs E-?_ ^ - E-_ E- - - ) -_ -_ ~ -0 E- - E- Bsx As  Ds Cs E-?_ M ` E- - LD sm y[ s  sm K <n Z F @ -8n E- - Q <$ T 2s`n ж -n s : sA > "-^  #-n s $-n N %<(o z &s`o E  so I !-o  '- # (s F )s  *po  +s  ,s p  -sPp d .s  /sp  0-p E- g sq Q f Q - ] >   sPq e s : sq s\  sX ߼ sx 1- E- ) > + F o -q - {& 3- - -J a -* < -q G -C E-˽ s >P E- Bsx As  Ds Cs E- - - - y[ s E-- K s Z f -  -  s E- ) > + fpr ^ -  - e s a - > -- G -. F-0 E-H - -( - E- Bsx As  Ds Cs E- - p - @ -* @ - @ - y[ s E-- K < sr Q E8[ -r  -r \Y -Z  s E- ) >  -  -s  -  -  -@s  - E-˽ s >P E- Bsx As  Ds Cs E-h E- - y[ $s ; s M 4sЅ - X -8 ] <g E-} s #' p %c s`  s  s  s  s  s0 ; -  -  ]p`  ^p  _p & `p 4 ap = -K E-b VT <X . Fx . B< u E- g Cs Q @E8  Ash @ p s W H/ M L< a P: J M- T I- ^ Q-  d<  e-  s s  - o +s2  ,s? W -<` iE \s E-c ! D- u >~ < E- - {& - -H - ! Usp ! s ! - %! -( ,! -` E-;! K! (- ! -U! b! "-f! }! #> ! )-! *-! ! Zs ! [p( ! &-X ! '-x " %- " b>" ," -ȍ 7" -;" S" Vs Q" W-0 ^" -p j" - z -؎ " Ts " GsH " X- " -" E- 5$ 8-" P$ 7-" o$ 6-" $ 5-" " 9-" # <-# - >- # ?p # 7# :-=# M# ;-U# g# Fs Lm c<t# # -h # - # -Ȑ # Ys # .s@ # /sp # 1- # 2-ؑ # 0p $ -@ E-˽ s >P E-$ $ -$ 2$ -:$ M$ -W$ l$ -v$ $ -$ $ -$ $ -p $ -$ $ - % -Ȓ % - % -( (% -H =% -x n -R% % - m% - % - % -P % - % - K - % sP % s s s s LD sP s % s % s % s & -8 & -x -& - 4& -ȗ E- ' s s s n n M ) s9 P s] q s{ - - -@ - -  -h . - : - F - R -_ | - - - -H -  -p  - 6 - D - R - ` - M <;& K& - X& F `& -H t& -p & N< & J/Ș & R: & O<0 & K/h & S: E-ؙ & <& & < & < & -8 ' Fp ' F E- Bsx As  Ds Cs E-?_ ' E- - M Ts " @-9. y[ s E-} #' pХ 1c s  s` Q. - ; -  -  ~- E-b D3 sX. M )< W / a -: J *- T - ^ .-Ц o. - @ n l n@ s VT <x v. i< . F . <0 u (-` " s g s |. j< Q f8  sh <0 . Fh . < . < . f . sX e <. S" gs . h- ! 2- D- {& E-. . H- . P-X . Q- j" {- ^" 6-p / R- / fsث ! os ! pp( M <;& X& %F K& -8 & +< & !/ & /: & ,<0 & "/ & 0:@ / #-/ 1/ $-x `& &-H t& '- 3-ح 4-;/ % - E-S/ z 7-؎ b/ 8-( q/ 9n` / <s/  :sp>  ;s E / =< E-;! ! A- ! B- ! F- \Y O- ! 5-/ b! >-f! }! ?> C-/ " S-/ & Wp / p` " q>" E-} " 1-" - b-/ # cp0 4 Xp  Vp  Up E-"0 o Is<0 S0 Js\0  Ks? W L<` u0 M< ~0 Ns E- 0 rn 0 sn0 Lm t-0 0 unh 0 v- 0 w- 0 y- 0 z-` 0 e-0 5$ ]-1 P$ \-&1 o$ [-81 $ Z-J1 " ^-\1 q1 d- 7# _-x1 M# `-1 # ns 1 G-1 g# ks " ls $ |-@ 1 m-` 1 }- # - # -Ȑ E-˽ s >P E-$ $ -$ 2$ -:$ M$ -W$ l$ -v$ $ -$ $ -$ $ -p $ -$ $ - % -Ȓ % - % -( (% -H =% -x n -R% % - m% - % - % -P % - % - K - % sP % s s s s LD sP s % s % s % s & -8 & -x -& - 4& -ȗ E- ' s s s n n M ) s9 P s] q s{ - - -@ - -  -h . - : - F - R -_ | - - - -H -  -p  - 6 - D - R - ` - E-ؙ & <& & < & < & -8 ' Fp ' F E- Bsx As  Ds Cs E- - E-<2 %c sȳ -Q2 2 -k2 $ -$ LD sX s 5$ -2 P$ -" o$ -" $ -" @ p $ p@ . sh E- s VT < g < 2 < M < W / a : J - T - ^ -Ц E- Bsx As  Ds Cs E- - D3 s13 E-- K s= Z F E- ) > + f > -L3 VT -i3 a - E- -  Gs  HsX I- LD Fs E- Bsx As  Ds Cs E- E- - K < Z c ) > + c s Q f y[ s m -O v -d t -| Q F< E-3 @ - @ - p - ; -B @ -% 3 -3 E-4  s f s -  - 8 -A \ -p -P  s$4 < T -p E-  -  - ) !<p E 7 <ȸ E-<4 s s I s > -P c - E-L4 W #/X M "<0 a $:x J %- T &- ^ '- h4 - - E-˽ s >P E- ' s s s n n M ) s9 P s] q s{ - - -@ - -  -h . - : - F - R -_ | - - - -H -  -p  - 6 - D - R - ` - E- Bsx As  Ds Cs E-?_ VT X E-p E- - C - C -( 7 pC C pH y[ s Gp C L- C M- Q F< E-D 9 s sD < Ks7D @ - SD J-X N-XD  O- E-qD D - ; Hp b9 Ip D pH E-˽ s >P E- Bsx As  Ds Cs E-?_ x E- - 4E s y[ s E-- K < g < Q f8  s a -nE Q - @ -E E- Bsx As  Ds Cs E- E- - -JG Q < iE s y[ s E-3 4 -hG G -0 G -` -G E- u0 <G 1p s G s  s e s E-˽ s >P E- Bsx As  Ds Cs E-?_ q E-H E- - - y[ s E-H ^K -H Aj -H H -I I sI 1V s R s  s@ 6P s(I  -8I E--  s E- ) > > -p a -NI E- Bsx As  Ds Cs E-?_ )Q iI E- - Q <K T sh y[ s s  s$4 CK </K M <IK W /dK a :}K ] <K K -K K -K  s - E-K L -K  <L h sL 7L <AL VT -\L K < E-xL @ -L L -L L sL -L ) > > -L E-˽ s >P E- ' s s s n n M ) s9 P s] q s{ - - -@ - -  -h . - : - F - R -_ | - - - -H -  -p  - 6 - D - R - ` - E- Bsx As  Ds Cs E- E- - y[ s - s E-L4 <@ M <@ W /` a : J - T - ^ -0 ] <x FM < K& - NM -( E- ' s s s n n M ) s9 P s] q s{ - - -@ - -  -h . - : - F - R -_ | - - - -H -  -p  - 6 - D - R - ` - ߼ sx E- Bsx As  Ds Cs E-?_ VT X E- - E- < -M < -M [ -M Y -M r -M C9 -N - 5 -(N  -CN -_N  -tN E- - K <  sP - P &- n -  ?s Z f ߼ sX g s sP Q E8R ) > + f o. C- a 5- E-P > '-p ` s P s  ,- 6P 9-$P R "-

-  Fs Q <- $Q !--Q .- Q %-@ G $-. E-h IQ 1M E RQ 2s \Q 3s gQ 4s( E-oQ  sP Q #- # Es F Fs  n Q D- Q s Q sH  sQ Q < Q ;- f <  s8  sp 8 @- A- E-Q N < Q F@ z sp Q E R s R :- E-@ R 6-h "R s +R 7-4R OR s XR 8- bR s E-˽ s >P y[ Bs E- Bsx As  Ds Cs      o ܈  8e0<) oo:oo|-ox6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv  & 6 F V f v           & 6 F V f v           & 6 F V f v           & 6 F V f v           & 6 F V f v         &6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv  & 6 F V f v         !!&!6!F!V!f!v!!!!!!!!!""&"6"F"V"f"v"""""""""##&#6#F#V#f#v#########$$&$6$F$V$f$v$$$$$$$$$%%&%6%F%V%f%v%%%%%%%%%&&&&6&F&V&f&v&&&&&&&&&''&'6'F'V'f'v'''''''''((&(6(F(V(f(v((((((((())&)6)F)V)f)v)))))))))**&*6*F*V*f*v*********++&+6+F+V+f+v+++++++++,,&,6,F,V,f,v,,,,,,,,,--&-6-F-V-f-v---------..&.6.F.V.f.v.........//&/6/F/V/f/v/////////00&060F0V0f0v00000000011&161F1V1f1v11111111122&262F2V2f2v22222222233&363F3V3f3v33333333344&464F4V4f4v44444444455&565F5V5f5v55555555566&666F6V6f6v66666666677&767F7V7f7v77777777788&868F8V8f8v88888888899&969F9V9f9v999999999::&:6:F:V:f:v:::::::::;;&;6;F;V;f;v;;;;;;;;;<<&<6<F<V<f<v<<<<<<<<<==&=6=F=V=f=v=========>>&>6>F>V>f>v>>>>>>>>>??&?6?F?V?f?v?????????@@&@6@F@V@f@v@@@@@@@@@AA&A6AFAVAfAvAAAAAAAAABB&B6BFBVBfBvBBBBBBBBBCC&C6CFCVCfCvCCCCCCCCCDD&D6DFDVDfDvDDDDDDDDDEE&E6EFEVEfEvEEEEEEEEEFF&F6FFFVFfFvFFFFFFFFFGG&G6GFGVGfGvGGGGGGGGGHH&H6HFHVHfHvHHHHHHHHHII&I6IFIVIfIvIIIIIIIIIJJ&J6JFJVJfJvJJJJJJJJJKK&K6KFKVKfKvKKKKKKKKKLL&L6LFLVLfLvLLLLLLLLLMM&M6MFMVMfMvMMMMMMMMMNN&N6NFNVNfNvNNNNNNNNNOO&O6OFOVOfOvOOOOOOOOOPP&P6PFPVPfPvPPPPPPPPPQQ&Q6QFQVQfQvQQQQQQQQQRR&R6RFRVRfRvRRRRRRRRRSS&S6SFSVSfSvSSSSSSSSSTT&T6TFTVTfTvTTTTTTTTTUU&U6UFUVUfUvUUUUUUUUUVV&V6VFVVVfVvVVVVVVVVVWW&W6WFWVWfWvWWWWWWWWWXX&X6XFXVXfXvXXXXXXXXXYY&Y6YFYVYfYvYYYYYYYYYZZ&Z6ZFZVZfZvZZZZZZZZZ[[&[6[F[V[f[v[[[[[[[[[\\&\6\F\V\f\v\\\\\\\\\]]&]6]F]V]f]v]]]]]]]]]^^&^6^F^V^f^v^^^^^^^^^__&_6_F_V_f_v_________``&`6`F`V`f`v`````````aa&a6aFaVafavaaaaaaaaabb&b6bFbVbfbvbbbbbbbbbcc&c6cFcVcfcvcccccccccdd&d6dFdVdfdvdddddddddee&e6eFeVefeveeeeeeeeeff&f6fFfVfffvfffffffffgg&g6gFg EE@] f  i1  Nn @! 0) Pa`+R З=[ JV N` pPe 0S; VH P  Yc @[m `^ )ay[ Ieu @W`g| ah vl `{n q @  t ``u @w `{ @} @~ 7 LZ l q | p G `  n    o  6 @     ` @  ` { ` E 0  @# j p. @ I i1 P  U  p pi p# p p6a pi p* p5 p@ pI pR p[ pd pm pv p} p p p )a )a )a )a )a )a )a )a )a )a )a )a. )a< )aI )aV )ac )ap )a} )a )a )a )a )a )a )a )a )a )a )a )a) )a: )aK )a )a )a )a4 )a\ )aa )aq )af )aj )aq )au )ax )a} )a )a )a )a )a )a )a )a )a )a )a )a )a )a )a )a )a% )a- )a5 )a= )aH )aS )aZ )aa )ah )ao )ay )a )a )a )a )a )a )a )a )an asn1=SEQUENCE:LDAPMessage [LDAPMessage] messageID=INTEGER:1 extendedReq=EXPLICIT:23A,IMPLICIT:0C,FORMAT:ASCII,OCT:1.3.6.1.4.1.1466.20037 @| A B H (' (' :,xY4cO/<8?~%r 9캐[:Xl0B71jj )F˅ 0^9""4ah7=.J[HcӖd4ѠѮl/HC!0_ޣpx. }nBܷF6MF= btơu%]oO4~o0o٠]\ A2 ¢~h\(!XcLNKMX\Ug}n To@gL[<zgi @v&CV(_;i6,Qw/W{b;@{h 8!]F#rQFyٽ,W~={k&'jw,B҈ӒQd\lG %??! ]Te}ðhϛGjZ 7dy=a!t]LQG\LzrSxH:џ}G{tPVW+AV8F NDC!]n&1 !Ľ$PH,.I_W'6 +٘4PXTctvR{(JN؜y؛f/ϬyEx~"Qg&#8pMO@~rR332g蠋kE vϑMLoPF%ho0i](Hޙ?_ s$ ]*?'b{tbSa'z MTXItU~#Za~qM4)h^ lAsj~21lՅePfeo?nAj)}G0 j3=S.Ys>u1GzR٦{8h~KS[Yqenfk6(ץ,9&Kښp7V#^9OCeòp[PI(1gPޛ~, Pa孽6N@} K}!ڻbG6g茪8a>ʼns;lIǟ D0پ[_׉t),TQޠ/$kwޢhR SP@1VSz"Iqi&+pSFbP3K$ ke8`$ԜLz"0!?܌`0&9>dQ'^v͆3;<~ w"0qt035V4Go;X ܏pAzҚ5 W wTt>O|Lfέ=P!mĮ8bl ي] {1;VhU t WmNXOXWt|K]DX .Lr"]+-`V+!9X7ʣwn3m_3.4B_ <'~݇UiUzq]:xC)I^yG.c礋TD]c,~e% O:J褃Ix߬,7>yU؜l[z[[us'y(EX#l)PQ8L5{0^t?.3tu Oeo7ͶoP^}ֻ@Ն&A>s*M\-j(uL#,re<%? Nnzzy0 -d tHN5PD0Jmk.5R&7 o{@bo]/; hitCJrl.4^v>EJzg81{T Xٔ]^PkW*];)!AG UMp⊊#6)TfX }]lHS+G4>?VCeZp>b?[P]gb)m]W 2j5](Ą%c>0WE4:wa=J]yK/%(iw|Ju.+P2COw" iX 5maJenbj9 ANHs/U7kE.&c"^ͮbN-iOA~6)Y7d@2&0`nԳD3LJǒB6>tcY 6E+6^ʫIӫc W<I]^#8 "]V2nic'NXpNl^jCElf\}\xU3K<;XyjSiWq[BI薀H|t~kT75{9O.ev XWn?L-F(:H峄GXŬ#͖^A{KS ImQم:b1\nM{QY\̭˓iqc3;#z=ok[ښٕv8ӽJpM‘MT,ߪw(*,|& QMvvEOvq,T ouMʓH0J%/I25 IBљ#*!Q'*I ϞD'A W6\~t+_j3,*'Wj@OL:].꽂^Cqշx:D&eSVODUG?B߼ iT[|IϿBOd儇 p%8ӴxO?NKsz{w,å12U5wbFa00ࢌ)D_MR("6eT_- Nۤ/7A)G7Z?AIWΠ??FtS0Mnrsy`.*}|MD؊P):)ٯ:G]33[J_[88^΁DfbdOv#ak÷3cx2; Xꭼw1Y% .b\hv#E P?Þ;TU2tF,~` {9Z qE9MڍDH1%GۘVfHLl,TCvvh oՓʛ0a ʙ/fVJ.4U+J|gmk[́\:6zдW&e=;<IJM1^O=f"}Ư<>oz/̍"(%ԔӪЅo Ur >4, E'/U>xx.әl?v:0v0JPXԹ4BNGTEeKЅS~Y Wj؟w@c!uv'A0_Ƥ0S6.ٕ)F`'o>1*N|.AO#!MtD9iK.v^De1 ,g=.ӗTES|?ɬ kr$BCR-Ӊ(vUg9ٷ jQz:;A[]3hSdÊFDloEg<"Gzy znS옂W8U:Mr7J6T?g׸nO`+Z Q30F&8ɗ2-Y8ffN{c?ҭB) (YX}\C~ c-a3QFCNa(epC!v{@'>kwmΚw١@k!ܖrϕ^%`9Tlu88MB%f V&MXqjܐ6nC,NfcHо$#.0;/3x n3' 71MC̠I-7Ӑ_1iK석+ݛX((Tl% OG®/m)=(CLyYuwVCڬBʕs&T:7d1@YrMa!BLx1|{jT8T/ڟyBʺ!+JN5=Ů'0E;C>5 S2+]XҫSeIHM]`EJ`+7c XC~ܡV^i0~v_Xϻn2Ho|ȏӆ"Iܒ Mvg@[TfHYU;췈0rBe⑧ERQ25#< ճy[Gֽ!i,cnʄ02-I*@|E6G~.[v쉌%w۔"ѩc۴CN/hP /[Kcz0.e(왡ztTЯXNP~1 ם0&0HXTZ l8y9/^!y92rɐί &_.^f/}"mh>nēB dR\ AxRv?k "r{C &&Pzɡʨ,W>PEz,Y{4谞'Ż0'ۤ7dȆLdNL{̠q4HF7ΰM9/|ϐ[7(BY5Fn)zwg+6ׁ]8hI}<60z!u`>BGI\i}<5lcbaa\bb #l=,Kr'6e8WjOQА#e<,0Z8byK ?_F&[(MߓŔKB5kiav 3 KˑzGyW= InF:˴[0% 6Z1scnTSiT؄р W&Ed+E7W0.]tRރsa!b0l6Q{QI'ݽy9=emR`ȋ3׾CM+FTDRdGlJd?!/r|&߀PԔ}qدt63XcseD %ݘݼ ,CA¡7pZj06!i>8M4G~&%&NUMJYd~r}}+,܋R V&yq Y'h=6Uwi?cp!7бWzc V;YljT-x}N [b; $N=Z>=83^7L+X%X#ƃx݉ nk7tڠZ+( Pd~(;&9VrMg7,n1Yx]'E1!ά~2v1ĺZɞt&nmC b4IʓBK#yXfܫ3"+\{.RrxJISv-.C<9ta3*UJ痦@ARfϿMɾcv58y#H`8_kg[A ^KN[Gb#ٶ.]l|U Ϭ7jO@yJy&5M>9l9_RT$|n>J@lcDRSQG.N :&S ũ֊)uͶ{d|~ HJtLS={jw/,yD7;=)ˉdKWk '/= <s}pieKtI!d3P3b[ rQ2:dsh[p\gE`W+G "sV3> !+nk ݵI6옘 ~gjz Q͡mTi j^ \g-f3"X陯 *Vm@7gzT[r֥#9xȃtyž =4D+"G1ke__]Sp7M|Jуܲ=xX9P-D#6_ߞO㌿>IyXG/!c2culnhHY4C Tg!8 @..JQݺ#f*ʜl-k}hRV/U) N] +֛Ҙ)E\UeͬSFߥX|.FF/֪!~vb; 6yUd*N;D|N7&xm$kH!g"@?զ^MUq–%GDoS+wf~z(e1ׇ)[tQ{Ѝrw oI~$2pYp}Ėa; 츜 w'5fF1jR] ,4zj!B1H'y{QK[jqE07ޢh -Zݑc_yڙ :KCpWĶύ*#o_J'2$d,9/K~e\nĶ+Q.`ug+vAB)ʷa: odqembvmkx"2cS}흂,\݅Ҭn`.vʱrP[9|ioIRg#C,|;ea޵cslp,s쇒 g֜5HH;DsY{vM[/_)n7֪O^R0 'FezC!Ipч)6f-{ 8َx'ϵEX=!Rhax(l_\=A. _5P3},;$15sƘxf1ͦ _Y:5T!j+qf;AR2RQU2O;+amhy4IC|N^1 $"5̢ [eqd>3NAT2x~OFjx?_g LQQJXd٢2T68 `2jGA;~Ŧ3gl~Ô,,iN{@M*'Z-?}QpP8M6y.+}/J ޑǯ흸le^gb:gWVJXnp)hEͥD V&ХIn"{X:RL\|{2Nd%k}v"S1kץk8 '3󚮔 m'U)?&T#<\.!#%.oT{ka Qﻹf,%v˿z/V3ّ1rJ!BNl'"峣瀻Rdf%o ;6.+OƱ[ {5-D>DG&q{mK,l!ΓI4iI>q[~^T<) Ƥax~ 국h ')|p* 9vr0^JUF_a%z=o+Ij¡ 1BCN||`貐! |cn[i=w;&'*ܕOB m 1!8\yAt (R/M0ŦaBOfc5-;q% F⧣ͿX%_ *FKfrQ6Rq!O+&PL|.Tv%H9o$dcDol?/xӷ&ۍ7M\åuLoXU2n+EH@ع<s[qw?o6Q_~PzM֣v$_[\dq6a'}}՜ZTUE-XR(eRE+alY{땁)R25ʑ2bwC,Ax'P."볥' &~9r"cyjUaA7)RN1D.A  ·bh'[ZzKs@xB(^qzx>,9r,]Ǯ)ha7}} GhFVm{Q{5 z*CH#ma@c+/aLp=xO 5mm79}3TӃe}':k悎X-8l;GXpMF4` <@2u#lWs L\~Nus-TUɼ˷Nj }Ј!C s}T}c^' n~Z M9;|s9Z}r2XqnfY֬S-FX.M}JLWTY,m=*)`DSԩ~!n^SY7qpc*)ךvGN1O*ejKCy8A65E<6Hw teThD,͇;) rLTfA=>_/Xh1WuM8}V4+@|"&}W(8qy!BRfJnGպ7|ocDݱ0mͿ4'Y}yܖ[N@k:dp$\t^gJʾNH}YbPSF[Z=spYk^*jN#8ֳ q-ܥ3ݢ>XSnx5xCcut q$aSM9 "/ԙt:cLZZo)3P'grcȈKջv۱כoz\,`. m+yF$\2T/xs u#Y[$u/R! %]OEʠTo"Ͻ#􏙧g;I5O76u% l>-29K__n~Qٳ7@}rS-~`I1Le:Mc!xk@[Iu#;ŀ`'zwK>uC&qrprp%j-yeN}\[7CfHlgdu6%Ut,(v= jZc>1)~3K(-:Q&.)G]c)emxc1rTsr&HWW('b1XzrnEg&%dE186FNq_ AȔs0Tv#"zB2Fy zy=2b)s Q#>t$ `6*(M憘|!3T O|mcs* 8Q#7f?Gos!ktOš2n2Bz=yCzC FxMg)+_pJjZ¬ǭ b,?VPr*؄1c' ^x1Kw\P7fkT]nX TF~ !1^ g2V XVB5ld ?f_>9]2Hle4P[.y b5ohiH]4ArZqGo@@pc6;)0 )qC;QWq+e!S_()O|D(AOj(P9gS,<˖A@2pe:"yj̙r}m䐵pNH`*z=$)ڽפ`-"ek(/y|CBjEO.4T}my.QMyVD7ZHH?,QFAƑrUs,tP:/mwmE i'e^4Ӂ=0C#Bv1sFa 9@zۀ, 4ԒlnOϯLwvrGќJ3nuv1w)R.R0u ͉ lW'=/\v)K xraao9N>Ǐ68%zJԠ>!9r=P]_?mU ![&+wOv,"j办VxD^`ey1#.t॔KXU346Wy.;N!\HJ`)S--o B.q1mo+#ߴ@, }}Kߑk iif[F}pm~uNwMA?bq^8K,0oI.ɚ] U:%#Вã/MUZ1u,A_uc,h˓QsI`&FP_YT͘At_ `{< 뤓ʚ'e[yn&(;smSX`\vCX$; $ET7c}t!HĔD"-->Z1ܕAX@_ڬ?*kX_Hx $< %kBl61z&v jb |I wgG!?C!F0bQrHg͞!0A4w>9g*{/@pO? vJ5NG+]tC3{I@fbz˓SԀH'KAa߿=q %qJWl!}5EjC\T_$.@ޒ#YҡL e[·Uq< $ka3B+wtyyϭW5 tqXk2]vH9#wJp>lR$ AZz^15uĖt۴Ȍ;fPGeb4X5j,Zhxdk>Nz¶vœjiV4J n5`#0d9`vQJ<:, `iJ!IT X!QG>TFٶdT/ϥ(9v[-C$oio}_x@ (eƞVpRҔJ%L.y\ՎTU%vcP"/XXykAg&lWa:}1-8b6BB$ge |oDɫLE{80X+] TIM"@P.x(x$V—,Cfr_S챱^@ H{?j!5GŊO^c`q[JO`ƺJ$ .:΍'! QU0c׍ąN'|.墣Lc9wfʠqP=5.`haCʚ#JEraww*-Va^jFJ?PֺוeSánCӁFFHNy@4q^J^Op-=:ը  9_!1trkd5a 9!f |ʡZqT(pCl{hMEF C,FN&.۰U*PD!0;#3ʣLR6?` Q qw:0!=$.:%Bjhyi.˹-Q5˾_XT0wP/W Bʅ sG 9b?g]$`)L='jPF<#9Zb?J^ISuC)"Ń Wm"$+Kg7ۏ8CD?LS.=fL=1lߖ3#GYu)wԐ ?LէA󀎱c?+sսQjȺMT8Шu"aQcOшI0G0\u؉EQ!o0o3$  (#kL:%OyO9]_4T@LZE ߡjpwFD+u2l'i\sGd+B/,i'ѵ#Ņ-CMIt~$ϜE@*(@)ɰ#~2Ƀѝ>շ}ec]]ύ p *q}ǸbpJO6%jF߾wVm%_[7̹J3cCCC@)|+6S} MRt_!\:Z%!vL|qPq'[# ![(=%*-}x~ $*\*hoVs:N#"jtx?DwQ0>|I ˊf$3;@VP澄 %Ӝlb]+}=zlTQ [GdUZ7%}!ioɊ@zp NFz۳˃#ĽԪ]1FΞugSGD%s~ЎYѲZ/9ͣ¹ǹHƘMʄl)Y5dY!3kQ^޸_ƹ"eFD#33kYtj>6P!Бl/&0ej0VboVqIZM4Xy0UlZL,YV蝯 xQUC;l -A(Пj~ Ы|}5'IQcd>amS9'Ogw:o s>z(a#+΄W~%Te̕ 0YakNCy% Hh f+vFNY LeHxC,$}ZpEl)@?[GD9rzڪ* T#7[a ~$sm@r HlF9OxFj1d 8<*+16`-t2蜓n{q%8*7Dΐ?RR"8v iXj}|,2O 7C]$'FTSbq+qAu:a)F:ck0N% U˃uk4A)jUMp쮇8 EwnW`W"ˏ3:7o림Sp!v>/E$Y2.;#x=gO7NGL-OA.-",SU+?X:0ڰ-O&8=pQQy2{-'ŜyRS"絮nUe LsjI)aF X׈^{BXEA  1W=[/_OGV? )[Iz*!,IOQmKKR, I8 M8  i v i R8 C f C  C C  : 9 C < C C = J ( h 8 h K ( H- Y ]   y[ @_ ] > _ ] f f f g g (g 5g Ag _g zg g g g g g h h 4h Dh Sh dh uh h h @h h h h  D N h  h h i ; ;  i i %i 6i Mi ^i ui i i i i ; < ` ` ` i i i k k k k  l l .l Dl Rl fl {l l l l l l l l m m C(m 6m Dm Wm km {m m m m (m *m +m ,n -n .2n /En 0Qn 1`n 2nn 3}n <n Fn Gn Pn Vn Zn do mo n-o oGo p qZo rvo so to o o o o o o o o o o o @p Ap B(p 4p C925e2efd4f18153e32db1efde41e2d73ec6b1b.debugc.shstrtab.note.gnu.property.note.gnu.build-id.interp.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.got.text.fini.rodata.eh_frame_hdr.eh_frame.note.ABI-tag.init_array.fini_array.data.rel.ro.dynamic.data.bss.gnu_debuglink PP pp$19oC K܈So|-|-T `o::`o0<0<)yB8e8e~  0gPgPghh8@     H H[[        xx  x5@@@} @@H @4t